DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and LOC100537194

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_017211404.1 Gene:LOC100537194 / 100537194 -ID:- Length:306 Species:Danio rerio


Alignment Length:163 Identity:38/163 - (23%)
Similarity:69/163 - (42%) Gaps:25/163 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EKFSIQVNEGNTFGALVKAE-PFTKIND---------GYYFFGTESLNWYEAYEKCRELNSELVT 76
            :|..:|.|..:.....::.| ..|.::|         |::|  ||..:|.|:.:.||...:|||.
Zfish   157 QKSQLQNNSNSLSQKKLELENRVTSLSDELKKARSKQGWFF--TEEKSWSESRQFCRNRGAELVI 219

  Fly    77 FETDQEFDAVTAFLTANGSRLTYWTSGNDLAKTGSHRWFTNAQRISSLRWARNQPDN-AGQKEHC 140
            .:::.:...:::.:..:     .|...:|....|:.:|..|:...... |||.:|:| ..|.|.|
Zfish   220 IKSEVKQRVISSLVKED-----VWIGLSDTETEGTMKWVDNSPMNQGF-WARGEPNNYRSQDEDC 278

  Fly   141 IHLGYIYKDSRKFELNDRPCSQDPNSLFKYICE 173
            :.:.........:  ||..||...    |.|||
Zfish   279 VEVRISQGIPNNW--NDLRCSDRR----KGICE 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 29/122 (24%)
LOC100537194XP_017211404.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10954
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I5416
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.