DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and clec4e

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_004917035.1 Gene:clec4e / 100497788 XenbaseID:XB-GENE-6035508 Length:218 Species:Xenopus tropicalis


Alignment Length:188 Identity:41/188 - (21%)
Similarity:76/188 - (40%) Gaps:35/188 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLLITLLVIAKTGWTREKFSIQVNEGNTFGALVKAE-------------PFTKINDGYYFFGTES 57
            :|::.|.:...|..|....|...|:...:.|.:.::             .:.:..|..|:..|:.
 Frog    41 ILILALFITVITRSTSGSSSADSNDLKNYVAQLASKVNAMEAKKEACDSAWIQFEDSCYYITTKK 105

  Fly    58 LNWYEAYEKCRELNSELVTFETDQEFDAVTAFL-----TANGSRLTYWTSGNDLAKTGSHRWFTN 117
            .||.:|...|.:...:||...:::|    ..||     .:|..|  :|...:|:.:.|:..|...
 Frog   106 TNWQKARSFCVQEGGDLVVVNSEKE----QKFLKEKSGVSNLKR--FWIGLSDIEEEGTWTWVDG 164

  Fly   118 AQRISSLR-WARNQPDNAGQKEHCIHLGYIYKDSRKFELNDRPCS-QDPNSLFKYICE 173
            ....:|.: |.:.:|::....|.|.||.     :...|.||..|: |:|.:    |||
 Frog   165 TDYSTSYQFWKKGEPNDHLTNEDCAHLW-----NPTGEWNDVHCTFQEPYA----ICE 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 31/128 (24%)
clec4eXP_004917035.1 CLECT_DC-SIGN_like 87..214 CDD:153060 34/142 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.