DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and reg4

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_004916045.2 Gene:reg4 / 100485485 XenbaseID:XB-GENE-952114 Length:161 Species:Xenopus tropicalis


Alignment Length:131 Identity:33/131 - (25%)
Similarity:59/131 - (45%) Gaps:21/131 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GYYFFGTESLNWYEAYEKCREL--NSELVTFETDQEFDAVTAFLTA---NGSRLTYWTSGNDLAK 108
            ||:.|   .|:|.||..:|...  .:.|.:...:.|.|.:.:.::|   ||.   .|...:|..:
 Frog    43 GYFRF---KLSWSEAEFECVSYGHGAHLASILDNAEADIIASHVSAYQVNGD---VWIGLHDPEQ 101

  Fly   109 TGSHRWFTNAQRISSLR-WARNQPDNAGQKEHCIHLGYIYKDSRKFELNDRPCSQDPNSLFKYIC 172
              :.||..|...:.:.| |...:|:|...:|:|   |.:..::|..:.||.||    |....::|
 Frog   102 --NRRWKWNDGSMYNYRNWKNGEPNNVNNEEYC---GELAVETRFEKWNDAPC----NIQNHFVC 157

  Fly   173 E 173
            :
 Frog   158 K 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 30/127 (24%)
reg4XP_004916045.2 CLECT_REG-1_like 30..159 CDD:153064 33/131 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X73
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.