DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and si:ch211-232p21.6

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_021327532.1 Gene:si:ch211-232p21.6 / 100334411 ZFINID:ZDB-GENE-131121-178 Length:149 Species:Danio rerio


Alignment Length:130 Identity:35/130 - (26%)
Similarity:55/130 - (42%) Gaps:23/130 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YFFGTESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLT--ANGSRLTYWTSGNDLAKTGSHR 113
            |.|.|:.::|..:..:|::|..:||..::.:|.:    ||:  .||....:|...:|....|...
Zfish    30 YVFSTDVMDWSSSRRRCQDLGGDLVVIDSTEEQE----FLSKKVNGVHDFHWIGLSDSQMEGVWL 90

  Fly   114 WFTNAQRISSLRWARNQPD-----NAGQKEHCIHLGYIYKDSRKFELNDRPCSQDPNSLFKYICE 173
            |..|....:...| .:.||     |....|.|:    |.|| ||:  .|..|.:..    |.|||
Zfish    91 WVDNTTLNNDTSW-DSPPDDWKAENPLDGEDCV----ILKD-RKW--GDVSCLRKE----KRICE 143

  Fly   174  173
            Zfish   144  143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 33/128 (26%)
si:ch211-232p21.6XP_021327532.1 CLECT_DC-SIGN_like 26..143 CDD:153060 33/128 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10954
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I5416
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.160

Return to query results.
Submit another query.