DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and illr2

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001121843.1 Gene:illr2 / 100147856 ZFINID:ZDB-GENE-050311-3 Length:253 Species:Danio rerio


Alignment Length:160 Identity:40/160 - (25%)
Similarity:69/160 - (43%) Gaps:27/160 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QVNEGNTFGALVKAEPFTKINDGYYFFGTESLNWYEAYEKCRELNSELV--TFETDQEFDAVTAF 89
            ::||.:  |..:.|..:|......|:|.|..:||.::.:.|......||  |.:.:|:|      
Zfish   104 RLNESS--GCALCAVHWTHSGGKCYYFSTVKMNWTQSRDHCVTKGGHLVIITSKAEQDF------ 160

  Fly    90 LTANGSRLTYWTSGNDLAKTGSHRWFTNAQRISSLR-WAR-----NQPDNAGQK----EHCIHLG 144
             .|:...:|:|...||:...|...|..|.....|:. |.:     |:|||..:.    |.|..||
Zfish   161 -LASKISVTHWIGLNDMHTEGRWVWVDNQPLNKSVEFWMKRVNGNNEPDNWTKNHPGGEDCACLG 224

  Fly   145 YIYKDSRKFELNDRPCSQDPNSLFKYICEA 174
            :....:..:  ||..|:    :..:::|||
Zfish   225 HSLGATEFW--NDDLCT----ATKRFVCEA 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 32/133 (24%)
illr2NP_001121843.1 CLECT_DC-SIGN_like 114..247 CDD:153060 34/145 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10954
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.