DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and asgrl1

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001107113.1 Gene:asgrl1 / 100000463 ZFINID:ZDB-GENE-081105-120 Length:270 Species:Danio rerio


Alignment Length:215 Identity:47/215 - (21%)
Similarity:70/215 - (32%) Gaps:64/215 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKLTVLLITLLVIAKTGW-TREKFSIQVN-------------EGNTFGALVKAEPFTK------ 45
            :|.|.|.::||.|..|... ::|...:::.             |...|..||...|..:      
Zfish    72 ILALYVFILTLAVGIKISQISQEVADVRLYMKTFVDAPKTPQFENGHFSELVMQVPVAEQGPCQE 136

  Fly    46 ----INDGYYFFGTESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRLTY------- 99
                .....||..|...||..|...|.:..|.||......|.|.:::.:..:.|   |       
Zfish   137 NWVFYKGSCYFQSTMKRNWKTAESNCIQKGSHLVVVNDLAELDFLSSIVKLSDS---YWIGLVEK 198

  Fly   100 ------WTSGNDLAKTGSHRWFTNAQRISSLRWARNQPDNAGQK---EHC--IHLGYIYKDSRKF 153
                  |..|.:.:.|..|             |...|||:...:   |.|  :|...|....|.:
Zfish   199 EEGQWSWVDGTEFSATEHH-------------WDVGQPDDWDVRVNGEDCGQLHSREIVNRRRMW 250

  Fly   154 ELNDRPCSQDPNSLFKYICE 173
              ||..|:..    :.||||
Zfish   251 --NDADCTLS----YPYICE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 32/139 (23%)
asgrl1NP_001107113.1 CLECT_DC-SIGN_like 134..264 CDD:153060 32/151 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X73
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.