Sequence 1: | NP_001188845.1 | Gene: | Lectin-galC1 / 35216 | FlyBaseID: | FBgn0016675 | Length: | 186 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021333340.1 | Gene: | si:dkey-28d5.7 / 100000161 | ZFINID: | ZDB-GENE-060503-259 | Length: | 360 | Species: | Danio rerio |
Alignment Length: | 243 | Identity: | 52/243 - (21%) |
---|---|---|---|
Similarity: | 73/243 - (30%) | Gaps: | 115/243 - (47%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 LKLTVLLITLLVIA-------------KTGWT------REKFS-----------IQVNEG-NTFG 35
Fly 36 ALV---------------KAEPFTKINDGYY---------------------------------F 52
Fly 53 FGTESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRLTYWTSGNDLAKTGSHRWF-- 115
Fly 116 ------TNAQRISSLR-WARN----------QPDNAGQ--KEHCI-HL 143 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lectin-galC1 | NP_001188845.1 | CLECT | 51..173 | CDD:153057 | 30/148 (20%) |
si:dkey-28d5.7 | XP_021333340.1 | CLECT | 23..127 | CDD:321932 | 17/104 (16%) |
CLECT | 130..239 | CDD:321932 | 29/117 (25%) | ||
CLECT | 245..357 | CDD:153057 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1509611at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |