DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax and DAR4

DIOPT Version :9

Sequence 1:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_197291.2 Gene:DAR4 / 831657 AraportID:AT5G17890 Length:1613 Species:Arabidopsis thaliana


Alignment Length:460 Identity:87/460 - (18%)
Similarity:148/460 - (32%) Gaps:170/460 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 HIYAVPNGSAHKSPTPGRHVTITVRETKTE--KLTGPDGPVGT---------------------- 219
            ||:.:.:...|.|.:...|:::...|.|.|  .::|.:.|:|.                      
plant   971 HIFVLYDTKMHPSDSEENHISMWAHEVKFEFHTVSGENNPLGASCKVTECGVEVITAATGDTSVS 1035

  Fly   220 --VEEQ----IVQQKDSYTPNHAVP--GQQVHQAYTSQATKELDDLMASLSDFKVSNGTNGIGNG 276
              :.|.    |::::|:.......|  .::..:...|:::.||..|.::.|..:..........|
plant  1036 GIIRESETITIIEKEDTIIDEEDTPLLSRKPEETNRSRSSSELQKLSSTSSKVRSKGNVFWKWLG 1100

  Fly   277 SHPQQHSSTVQHQTVTDYARPNKGSQQAHLTQTIEETTIVEDSRE-------------------- 321
            ..|      :|.:.:...:|.....::| |.:.::|...:||:||                    
plant  1101 CFP------LQPKNLRSRSRRTTALEEA-LEEALKEREKLEDTRELQIALIESKKIKKIKQADER 1158

  Fly   322 DQL-------------DSMLGNLQANMSRQGVNT--------VQKG------------------- 346
            ||:             |.....:::|...:..::        |.||                   
plant  1159 DQIKHADEREQRKHSKDHEEEEIESNEKEERRHSKDYVIEELVLKGKGKRKQLDDDKADEKEQIK 1223

  Fly   347 ---------------CCNACEKPIV-GQVITALGKTWHPEHFTCNHCSQELGTRNFFERDGFPYC 395
                           .|..|:..|. |..|.|.|..|||:.|.|..|.:.:......:..|. |.
plant  1224 HSKDHVEEEVNPPLSKCKDCKSAIEDGISINAYGSVWHPQCFCCLRCREPIAMNEISDLRGM-YH 1287

  Fly   396 EPDYHNLFSPRCAYCNGAILDKCVTALDKTWHTEHF----FCAQCGQQFGEEGFHERDGKPYCRN 456
            :|.|..|..|.|..|...|..   ||....:|...|    :|..          |:.||      
plant  1288 KPCYKELRHPNCYVCEKKIPR---TAEGLKYHEHPFWMETYCPS----------HDGDG------ 1333

  Fly   457 DYFEMFAPKCNGCNRAIMEN----YISALNSQWHPDCFVCRDCR----------QP--FQGGSFF 505
                  .|||..|.|  :|:    |:...:.:|     :||:|.          ||  |:...||
plant  1334 ------TPKCCSCER--LEHCGTQYVMLADFRW-----LCRECMDSAIMDSDECQPLHFEIREFF 1385

  Fly   506 DHEGL 510
              |||
plant  1386 --EGL 1388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830 16/52 (31%)
LIM2_Paxillin_like 407..458 CDD:188723 11/54 (20%)
LIM3_Paxillin_like 466..518 CDD:188724 17/61 (28%)
LIM4_Paxillin 525..576 CDD:188795
DAR4NP_197291.2 PLN03210 26..>844 CDD:215633
TIR 30..163 CDD:279864
AAA 166..294 CDD:99707
leucine-rich repeat 544..572 CDD:275380
leucine-rich repeat 573..594 CDD:275380
LRR_3 594..613 CDD:285026
leucine-rich repeat 595..617 CDD:275380
leucine-rich repeat 618..640 CDD:275380
leucine-rich repeat 641..663 CDD:275380
leucine-rich repeat 685..708 CDD:275380
leucine-rich repeat 750..772 CDD:275380
leucine-rich repeat 773..793 CDD:275380
leucine-rich repeat 794..824 CDD:275380
LIM_DA1 1240..1291 CDD:188782 16/51 (31%)
DUF3633 1387..1602 CDD:289113 2/2 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 47 0.796 Domainoid score I4515
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.