DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax and WLIM2b

DIOPT Version :9

Sequence 1:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001190099.1 Gene:WLIM2b / 824743 AraportID:AT3G55770 Length:233 Species:Arabidopsis thaliana


Alignment Length:206 Identity:52/206 - (25%)
Similarity:81/206 - (39%) Gaps:35/206 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 MSRQGVNTVQKGCCNACEKPIVG-QVITALGKTWHPEHFTCNHCSQELGTRNFFERDGFPYCEPD 398
            ||..|  |.||  |.||||.:.. ::::|.|..:|...|.|.||...|...::...:|..||:|.
plant     1 MSFTG--TQQK--CKACEKTVYAVELLSADGVGYHKSCFKCTHCKSRLQLSSYSSMEGVLYCKPH 61

  Fly   399 YHNLFSPRCAY-----CNGAILDKCVTALDKT-------WHTEHFFCAQCGQQ-FGEEGFHERDG 450
            :..||....::     ......||....|.:|       :......||.|.:. :..|..|    
plant    62 FEQLFKESGSFNKNFQSPAKSADKSTPELTRTPSRVAGRFSGTQEKCATCSKTVYPIEKIH---- 122

  Fly   451 KPYCRNDYFEMFAPKCNGCNRAI---------MENYISALNSQWHPDCFVCRDCRQPFQGGSFFD 506
            .|.   .|.|: |.|.|..:|.|         ...:::..:..:|..||.|.....|....::..
plant   123 NPL---SYREL-ARKPNVLHRCIDPGDIGSCYFNLHVTVESQTYHKSCFKCSHGGCPISPSNYAA 183

  Fly   507 HEGLPYCETHY 517
            .||:.||:.|:
plant   184 LEGILYCKHHF 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830 17/52 (33%)
LIM2_Paxillin_like 407..458 CDD:188723 10/63 (16%)
LIM3_Paxillin_like 466..518 CDD:188724 13/61 (21%)
LIM4_Paxillin 525..576 CDD:188795
WLIM2bNP_001190099.1 LIM1_SF3 6..68 CDD:188824 22/63 (35%)
LIM 108..202 CDD:295319 23/95 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.