DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax and AT2G28460

DIOPT Version :9

Sequence 1:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_180413.2 Gene:AT2G28460 / 817394 AraportID:AT2G28460 Length:720 Species:Arabidopsis thaliana


Alignment Length:309 Identity:59/309 - (19%)
Similarity:84/309 - (27%) Gaps:122/309 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   348 CNACEKPI---VGQVITALGKTWHPEHFTCNH-----CSQELGTRNFFERDGFPYCEPDYHNLFS 404
            |:.|.|.|   .|..:...|         |::     |:.:....:..|.:|.|  |.....:..
plant   355 CSVCRKKIDNDYGGYVCTKG---------CSYAAHSKCATQSNVWDGIELEGEP--EDIEEEVLP 408

  Fly   405 PRCAYCNGAILDKCVTALDKTWHTEHFFCAQCGQQFGEEGFH----ERDGKPYCRNDYFEMFAPK 465
            |.....:|.|                       |.|..:..|    |..|:.|..|       .:
plant   409 PFLEISDGII-----------------------QHFSHQQHHMKLDENTGRDYDEN-------KE 443

  Fly   466 CNGCNRAI-MENYISALNSQW--HPDCF-VCRDCRQP-----------FQG-------------- 501
            |..|.|.| ..|:.|.|...:  |.:|. :.|....|           |.|              
plant   444 CEACIRPIYFGNFYSCLECDFILHEECANLSRKIHHPIHPHLLNLIGGFDGVINYYNDKCSACIG 508

  Fly   502 ---GSFFDHEGLPYCETHYHAKRGSLCAGCSKPIT--------------GRCITAMFKKFHPEHF 549
               |.||...|...|:...|.:    ||..|:|:.              |..|.....|...|.|
plant   509 LCKGGFFYECGKQGCKFMLHVQ----CATTSEPLVHESHRHPLFLTSKPGEKIRCSVCKDSEETF 569

  Fly   550 --------VCAFCLKQLNKGTFKEQK-----------DKPYCHTCFDKI 579
                    :|.:|.....|..:|..|           ...:|..|..||
plant   570 NCIECDFALCFYCAILPQKVRYKHDKHTLTLSYGKETGTSWCEVCEAKI 618

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830 12/59 (20%)
LIM2_Paxillin_like 407..458 CDD:188723 9/54 (17%)
LIM3_Paxillin_like 466..518 CDD:188724 18/83 (22%)
LIM4_Paxillin 525..576 CDD:188795 15/83 (18%)
AT2G28460NP_180413.2 C1_3 243..271 CDD:284959
C1_3 298..327 CDD:284959
C1_2 353..384 CDD:281148 7/37 (19%)
C1_3 442..471 CDD:284959 8/28 (29%)
C1_2 610..639 CDD:281148 4/9 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.