Sequence 1: | NP_001033913.1 | Gene: | Pax / 35215 | FlyBaseID: | FBgn0041789 | Length: | 581 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001353159.1 | Gene: | ARHGAP28 / 79822 | HGNCID: | 25509 | Length: | 729 | Species: | Homo sapiens |
Alignment Length: | 195 | Identity: | 40/195 - (20%) |
---|---|---|---|
Similarity: | 70/195 - (35%) | Gaps: | 43/195 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 234 NHAVPGQQVHQAYTSQATKELDDLMASLSDF-----KVSNGTNGIGNGSHPQQHSSTVQHQTVTD 293
Fly 294 YARPNKGSQQAHLTQTIEETTIVEDSREDQLDSMLGNLQANMSRQGVNTVQK------GCCNACE 352
Fly 353 KPIVGQVITALGKTWHPEHFTC-NHCSQELGTRNFFERDGFPYCEPDYHNLFSPRCAYCNGAILD 416
Fly 417 416 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Pax | NP_001033913.1 | LIM1_Paxillin_like | 348..400 | CDD:259830 | 13/52 (25%) |
LIM2_Paxillin_like | 407..458 | CDD:188723 | 2/10 (20%) | ||
LIM3_Paxillin_like | 466..518 | CDD:188724 | |||
LIM4_Paxillin | 525..576 | CDD:188795 | |||
ARHGAP28 | NP_001353159.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 20..42 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 55..105 | 10/50 (20%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 176..236 | 15/54 (28%) | |||
RhoGAP_ARHGAP18 | 377..588 | CDD:239856 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 612..631 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1093 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |