DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax and Limd2

DIOPT Version :9

Sequence 1:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001343387.1 Gene:Limd2 / 67803 MGIID:1915053 Length:128 Species:Mus musculus


Alignment Length:101 Identity:28/101 - (27%)
Similarity:40/101 - (39%) Gaps:17/101 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 GNLQANMSRQ-----GVNTVQ-----------KGCCNACEKPIVG-QVITALGKTWHPEHFTCNH 376
            |..||..|.:     |.:|||           |..|.||:|.:.. :.:.|....:|...|.|.|
Mouse     6 GAAQATPSHEAKGSSGSSTVQRSKSFSLRAQVKETCAACQKTVYPMERLVADKLIFHNSCFCCKH 70

  Fly   377 CSQELGTRNFFERDGFPYCEPDYHNLFSPRCAYCNG 412
            |..:|...::....|..||.|.:..||..:..|..|
Mouse    71 CHTKLSLGSYAAMHGEFYCRPHFQQLFKSKGNYDEG 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830 15/52 (29%)
LIM2_Paxillin_like 407..458 CDD:188723 2/6 (33%)
LIM3_Paxillin_like 466..518 CDD:188724
LIM4_Paxillin 525..576 CDD:188795
Limd2NP_001343387.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25 5/18 (28%)
LIM_Eplin_like_1 41..93 CDD:188870 15/51 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.