DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax and Isl1

DIOPT Version :9

Sequence 1:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_059035.3 Gene:Isl1 / 64444 RGDID:61957 Length:349 Species:Rattus norvegicus


Alignment Length:150 Identity:45/150 - (30%)
Similarity:63/150 - (42%) Gaps:21/150 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   407 CAYCNGAILDKCVTAL--DKTWHTEHFFCAQCGQQFGEE-GFHERDGKPYCRNDYFEMFAPKCNG 468
            |..|...|.|:.:..:  |..||.....||:|.|...|. ....||||.||:.||..::..||..
  Rat    17 CVGCGNQIHDQYILRVSPDLEWHAACLKCAECNQYLDESCTCFVRDGKTYCKRDYIRLYGIKCAK 81

  Fly   469 CNRAIMEN--YISALNSQWHPDCFVCRDC-RQPFQGGSFFDHEGLPYCET-HYHAKRGSLCAG-- 527
            |:....:|  .:.|.:..:|.:||.|..| ||...|..|...|...:|.. |...:|.||.||  
  Rat    82 CSIGFSKNDFVMRARSKVYHIECFRCVACSRQLIPGDEFALREDGLFCRADHDVVERASLGAGDP 146

  Fly   528 ------------CSKPITGR 535
                        .::||:.|
  Rat   147 LSPLHPARPLQMAAEPISAR 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830
LIM2_Paxillin_like 407..458 CDD:188723 18/53 (34%)
LIM3_Paxillin_like 466..518 CDD:188724 16/55 (29%)
LIM4_Paxillin 525..576 CDD:188795 4/24 (17%)
Isl1NP_059035.3 LIM1_Isl 17..71 CDD:188752 18/53 (34%)
LIM2_Isl 79..133 CDD:188760 15/53 (28%)
HOX 181..237 CDD:197696
LIM-binding domain (LID). /evidence=ECO:0000250 262..291
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 312..349
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.