DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax and Pdlim5

DIOPT Version :9

Sequence 1:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster
Sequence 2:XP_006233474.1 Gene:Pdlim5 / 64353 RGDID:621076 Length:624 Species:Rattus norvegicus


Alignment Length:515 Identity:125/515 - (24%)
Similarity:186/515 - (36%) Gaps:159/515 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 QNSVPG----QPQQPQPQYGTVQ--------PKHQALQQQQFVDNTPGYGSLRGKAQPQVYQ--- 85
            ||..||    .|::| |:...|:        |.|....:::.:::|..:....|..|.:.::   
  Rat   235 QNGNPGTVKIPPKRP-PRKHIVERNTEFYHIPTHSDASKKRLIEDTEDWRPRTGTTQSRSFRILA 298

  Fly    86 -----EHYSVETRSPTAGHDFNGSSTTPGYANQGSLPRQAAGASTGLSELDSLLQDLQKIDVPVN 145
                 ||.. |:.:..|    ..:::||..:.|.:.|..||                        
  Rat   299 QITGTEHLK-ESENDNA----KKANSTPEPSQQSASPLSAA------------------------ 334

  Fly   146 YSTPVSKYNTMNSYATVEERPSVDSLLKELDNAHIYAVPNGSAHKSPTPGRHVTITVRETKTEKL 210
                                   :||                  :||...|.|...:|.....| 
  Rat   335 -----------------------ESL------------------ESPGSNRPVVAGLRSAAAFK- 357

  Fly   211 TGPDGPVGTVEEQIVQQKDSYTPNHA---------VPGQQVHQAYTSQATKELDDLMASLSDFKV 266
                 |||:..   |:......||.|         |..|.....:.|:|.          |..::
  Rat   358 -----PVGSTS---VKSPSWQRPNQAGTSMRKCGDVRSQHTQICFGSKAP----------STGRI 404

  Fly   267 SNGTNGIGNGSHPQQHSSTVQHQTVTDYARPNKGSQQAHLTQTIEETTIVEDSREDQLDSMLGNL 331
            ||..:..|.|: |.               :|..|..|..     ::.|:|:  |.:.:.:     
  Rat   405 SNSASSSGTGA-PM---------------KPAVGPPQPS-----DQDTLVQ--RAEHIPA----- 441

  Fly   332 QANMSRQGVNTVQKGCCNACEKPIVGQVITALGKTWHPEHFTCNHCSQELGTRNFFERDGFPYCE 396
                   |..|..   |..|.:.|.|..:.||||:||||.|.|.||...:....|.|..|..|||
  Rat   442 -------GKRTPM---CAHCNQAIRGPFLVALGKSWHPEEFNCAHCKNTMAYIGFVEEKGALYCE 496

  Fly   397 PDYHNLFSPRCAYCNGAILDKCVTALDKTWHTEHFFCAQCGQQFGEEGFHERDGKPYCRNDYFEM 461
            ..|...|:|.|..|...||.:.:.||.:|||...|.|..||:......||..||:|||..||:.:
  Rat   497 LCYEKFFAPECGRCQRKILGEVINALKQTWHVSCFVCVACGKPIRNNVFHLEDGEPYCETDYYAL 561

  Fly   462 FAPKCNGCNRAIM--ENYISALNSQWHPDCFVCRDCRQPFQGGSFFDHEGLPYCETHYHA 519
            |...|.||...|.  :.::.||.|.||..||||..|.:..:|.:||..:..|.|:.|.|:
  Rat   562 FGTICRGCEFPIEAGDMFLEALGSTWHDTCFVCSVCCESLEGQTFFSKKDKPLCKKHAHS 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830 22/51 (43%)
LIM2_Paxillin_like 407..458 CDD:188723 20/50 (40%)
LIM3_Paxillin_like 466..518 CDD:188724 20/53 (38%)
LIM4_Paxillin 525..576 CDD:188795
Pdlim5XP_006233474.1 PDZ_signaling 10..82 CDD:238492
DUF4749 214..305 CDD:292558 13/70 (19%)
LIM1_ENH 448..499 CDD:188837 22/50 (44%)
LIM 507..558 CDD:295319 20/50 (40%)
LIM 566..620 CDD:295319 20/53 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.