DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax and Fhl5

DIOPT Version :9

Sequence 1:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001342427.1 Gene:Fhl5 / 57756 MGIID:1913192 Length:284 Species:Mus musculus


Alignment Length:239 Identity:67/239 - (28%)
Similarity:101/239 - (42%) Gaps:14/239 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   348 CNACEKPIV--GQVITALGKTWHPEHFTCNHCSQELGTRNFFERDGFPYCEPDYHNLFSPRCAYC 410
            |..|::||.  .:.:....:.||...|.||.|...|..:.|..:|....|...|.|..|.:|.:|
Mouse    41 CEQCKEPIESDSKDLCYKNRHWHEGCFRCNKCHHSLVEKPFVAKDDRLLCTDCYSNECSSKCFHC 105

  Fly   411 NGAIL--DKCVTALDKTWHTEHFFCAQCGQQFGEEGFHERDGKPYCRNDYFEMFAPKCNGCNRAI 473
            ...|:  .:.:......||...|.|..|.|..|.:....::...||...:.:.||..||.|.:.|
Mouse   106 KRTIMPGSRKMEFKGNYWHETCFVCEHCRQPIGTKPLISKESGNYCVPCFEKEFAHYCNFCKKVI 170

  Fly   474 MENYISALNSQWHPDCFVCRDCRQPFQGGSFFDHEGLPY---CETHYHAKRGSLCAGCSKPITG- 534
            ....|:..:..||.:||:|..||:.....:|...:..|:   |..|.:||:   ||.|:||||| 
Mouse   171 TSGGITFRDQIWHKECFLCSGCRKELYEEAFMSKDDFPFCLDCYNHLYAKK---CAACTKPITGL 232

  Fly   535 ---RCITAMFKKFHPEHFVCAFCLKQLNKGTFKEQKDKPYCHTC 575
               :.|....:::|.|.|.|..|...|....|.....:..|..|
Mouse   233 RGAKFICFQDRQWHSECFNCGKCSVSLVGEGFLTHNMEILCRKC 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830 14/53 (26%)
LIM2_Paxillin_like 407..458 CDD:188723 12/52 (23%)
LIM3_Paxillin_like 466..518 CDD:188724 16/54 (30%)
LIM4_Paxillin 525..576 CDD:188795 18/55 (33%)
Fhl5NP_001342427.1 LIM <3..34 CDD:413332
LIM1_FHL 37..95 CDD:188729 14/53 (26%)
LIM2_FHL5 102..155 CDD:188812 12/52 (23%)
LIM 163..214 CDD:413332 14/50 (28%)
LIM4_FHL 222..277 CDD:188733 18/55 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.