DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax and lhx4

DIOPT Version :9

Sequence 1:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001116445.1 Gene:lhx4 / 571943 ZFINID:ZDB-GENE-060728-1 Length:391 Species:Danio rerio


Alignment Length:178 Identity:56/178 - (31%)
Similarity:77/178 - (43%) Gaps:29/178 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   405 PRCAYCNGAILDKCV-TALDKTWHTEHFFCAQCGQQFGEEGFHERDGKPYCRNDYFEMFAPKCNG 468
            |:||.|:..||||.: ..||:.||::...||.|.....::.| .|.|..||:.|:|:.|..||..
Zfish    31 PQCAGCSQHILDKFILKVLDRHWHSKCLKCADCHALLADKCF-SRAGNVYCKEDFFKRFGTKCAS 94

  Fly   469 CNRAIMENYI--SALNSQWHPDCFVCRDC-RQPFQGGSFF-DHEGLPYCETHYH-AKRGSLC-AG 527
            |.:.|....:  .|.:..:|..||.|..| ||...|..|: ..:|...|:..|. ||:.... .|
Zfish    95 CQQGIPPTQVVRKAQDFVYHLHCFACVMCSRQLATGDEFYLMEDGRLVCKEDYETAKQNDDSETG 159

  Fly   528 CSKPITGRCITAMFKKFHPEHFVCAFCLKQLN--KGTFKEQKDKPYCH 573
            ..:|.|  .|||                |||.  |..:| ...||..|
Zfish   160 AKRPRT--TITA----------------KQLETLKSAYK-NSPKPARH 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830
LIM2_Paxillin_like 407..458 CDD:188723 19/51 (37%)
LIM3_Paxillin_like 466..518 CDD:188724 15/55 (27%)
LIM4_Paxillin 525..576 CDD:188795 14/52 (27%)
lhx4NP_001116445.1 LIM1_Lhx4 33..84 CDD:188852 19/51 (37%)
LIM2_Lhx3_Lhx4 92..147 CDD:188762 15/54 (28%)
Homeobox 163..216 CDD:278475 13/45 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.