DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax and LOC556668

DIOPT Version :9

Sequence 1:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster
Sequence 2:XP_009295676.1 Gene:LOC556668 / 556668 -ID:- Length:1635 Species:Danio rerio


Alignment Length:398 Identity:69/398 - (17%)
Similarity:131/398 - (32%) Gaps:128/398 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LLADLQNSVPGQPQQPQPQYGTVQ-PKHQALQQQQFVDNTPGYGSLRGKAQPQVYQEHYSVETRS 94
            :|.|:|:..   |::.:.:.|..| |||        |..|      .||..|.::.:...::...
Zfish   472 ILRDIQSPC---PRKNEDKCGLDQKPKH--------VSET------NGKETPGIHHKPDIIDANE 519

  Fly    95 PTAG------------HDFNGSSTTPGYANQGSLPRQAAGASTGLSELDSLLQDLQKIDVPVNYS 147
            ..||            ||......|                :..:::.:.:|:...:....:..|
Zfish   520 VFAGISRAKQVFENISHDKENIPPT----------------NNSITQEEEMLKANVRNRAQMFES 568

  Fly   148 TPVSKYNTMNSYATVEERPSV--------------------DSLLKELDNAHI-----------Y 181
            ||:.|.|..    |.||..::                    .|:|:..::.|:           .
Zfish   569 TPLDKINLQ----TKEESETILEDMQETLLSLCNFSIIHSDGSILEANESGHVKKARYHFIEDTR 629

  Fly   182 AVPN------GSAHK---SPTPGRHVTITVRETKTEKLTGPDGPVGTVEEQIVQQKDSYTPNHAV 237
            ||.|      ||...   ...||.:...||...|.:.       .|.||   :.:.|  .|.|.:
Zfish   630 AVINEEEIVTGSIKSIMLQMLPGTNFNPTVTFLKEDS-------QGNVE---ILKVD--VPIHQL 682

  Fly   238 PGQQVHQAYTSQATKELDDLMASLSDFK----VSNGTNGIG-----------NGSHPQQHSSTVQ 287
            |..|..:..|:...:..:||:......:    :.:|..|||           .||........::
Zfish   683 PFTQDKECRTANVVQITEDLLGQEESLRKGVLIQDGATGIGEITVYALFIHSKGSTGLMGFGKIE 747

  Fly   288 HQTVTDYARPNKGSQQAHLTQTI---EETTIVEDSREDQLDSMLGNL--------QANMSRQGVN 341
            .::::........|::.:|.|.:   |...:||..:...:..:.|::        :..:|.....
Zfish   748 GRSISSSLSNGPASKKINLKQDVNSSESALVVETGKTSNVQLIQGSVKKEEPNHQETEISESTGQ 812

  Fly   342 TVQKGCCN 349
            :.:.|.||
Zfish   813 SEKTGPCN 820

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830 2/2 (100%)
LIM2_Paxillin_like 407..458 CDD:188723
LIM3_Paxillin_like 466..518 CDD:188724
LIM4_Paxillin 525..576 CDD:188795
LOC556668XP_009295676.1 PHA03247 <1027..1214 CDD:223021
PTZ00449 <1454..>1603 CDD:185628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.