DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax and pdlim3a

DIOPT Version :9

Sequence 1:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001019547.1 Gene:pdlim3a / 554148 ZFINID:ZDB-GENE-050505-1 Length:307 Species:Danio rerio


Alignment Length:58 Identity:22/58 - (37%)
Similarity:32/58 - (55%) Gaps:2/58 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   464 PKCNGCNRAIMENYISALNSQWHPDCFVCRDCRQPF-QGGSFFDHEGLPYCETHYHAK 520
            |.|:.|...|:...:...:...|||||||.:|.:.. |.|.:|..:.| |||:|.||:
Zfish   242 PMCDKCGNGIVGTVVKVQDKFRHPDCFVCTECEENLKQKGYYFIDDEL-YCESHAHAR 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830
LIM2_Paxillin_like 407..458 CDD:188723
LIM3_Paxillin_like 466..518 CDD:188724 19/52 (37%)
LIM4_Paxillin 525..576 CDD:188795
pdlim3aNP_001019547.1 PDZ_signaling 2..81 CDD:238492
DUF4749 134..214 CDD:292558
LIM_ALP_like 244..295 CDD:188746 18/51 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.