DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax and lims1

DIOPT Version :9

Sequence 1:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster
Sequence 2:XP_021335295.1 Gene:lims1 / 554019 ZFINID:ZDB-GENE-050522-236 Length:345 Species:Danio rerio


Alignment Length:240 Identity:78/240 - (32%)
Similarity:123/240 - (51%) Gaps:9/240 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   347 CCNACEKPIVGQVITALGKTWHPEHFTCNHCSQELGTRNFFERDGFPYCEPDYHNLFSPR----- 406
            ||:.|.:.|:|:||.|:..:|||:.|.|:.|...|....|.:..|...|.| .||....|     
Zfish    81 CCHQCGEFIIGRVIKAMNNSWHPDCFCCDICQAVLADVGFVKNAGRHLCRP-CHNREKARGLGKY 144

  Fly   407 -CAYCNGAILDKCVTALDKTWHTEHFFCAQCGQQFGEEGFHERDGKPYCRNDYFEMFAPKCNGCN 470
             |..|:..|.::.:...:..:|.:||.|:.||::...:. .|..|:.||...:.:|..|.|..|.
Zfish   145 ICQKCHAIIEEQPLIFKNDPYHPDHFNCSNCGKELTADA-RELKGELYCLPCHDKMGVPICGACR 208

  Fly   471 RAIMENYISALNSQWHPDCFVCRDCRQPFQGGSFFDHEGLPYCETHYHAKRGSLCAGCSKPITGR 535
            |.|....::|:..|||.:.|||..|.:||.|...::.:||.||||||:...|.:|..|::.|.|.
Zfish   209 RPIEGRVVNAMGKQWHVEHFVCAKCEKPFLGHRHYERKGLAYCETHYNQLFGDVCYHCNRVIEGD 273

  Fly   536 CITAMFKKFHPEHFVCAFCLKQLN-KGTFKEQKDKPYCHTCFDKI 579
            .::|:.|.:....|.|:.|..:|. |..|.|...||.|..|::::
Zfish   274 VVSALNKAWCVNCFSCSTCNTKLTLKDRFVEVDLKPVCKHCYERL 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830 18/51 (35%)
LIM2_Paxillin_like 407..458 CDD:188723 13/50 (26%)
LIM3_Paxillin_like 466..518 CDD:188724 22/51 (43%)
LIM4_Paxillin 525..576 CDD:188795 16/51 (31%)
lims1XP_021335295.1 LIM1_PINCH 21..79 CDD:188717
LIM2_PINCH 82..133 CDD:188718 18/51 (35%)
LIM3_PINCH 146..196 CDD:188719 13/50 (26%)
LIM4_PINCH 202..255 CDD:188720 22/52 (42%)
LIM5_PINCH 263..316 CDD:188721 17/52 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.