DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax and fhl1

DIOPT Version :9

Sequence 1:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001006703.1 Gene:fhl1 / 448334 XenbaseID:XB-GENE-964257 Length:296 Species:Xenopus tropicalis


Alignment Length:261 Identity:74/261 - (28%)
Similarity:97/261 - (37%) Gaps:16/261 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 MSRQGVNTVQK-------GCCNACEKPI--VGQVITALGKTWHPEHFTCNHCSQELGTRNFFERD 390
            :.:.|.||..|       ..|..|.|||  ..:.:....:.||...|.|..|...|....|..:|
 Frog    36 IEKDGHNTCVKCFDKICANTCAECRKPIGVDSKELHYKNRYWHDNCFRCAKCYHPLANEQFIAKD 100

  Fly   391 GFPYCEPDYHNLFSPRCAYCNGAIL--DKCVTALDKTWHTEHFFCAQCGQQFGEEGFHERDGKPY 453
            ....|........|.||:.|:..|.  .:.|......||.|.|.|:.|.|..|...|..:....|
 Frog   101 NKIMCAKCTTREDSLRCSGCHKQIQPGGRNVEYKGSAWHEECFTCSNCKQAIGSGSFFPKGTDVY 165

  Fly   454 CRNDYFEMFAPKCNGCNRAIMENYISALNSQWHPDCFVCRDCRQPFQGGSFFDHEGLPYCETHYH 518
            |...:.:.||..|..||..|....|:..:..||.|||||..|.:...|..|...|...||...|.
 Frog   166 CVTCHEQKFAKNCVKCNNPITSGGITYQDQPWHGDCFVCETCHKKLAGQRFTAVEDHYYCVDCYK 230

  Fly   519 AKRGSLCAGCSKPITG-----RCITAMFKKFHPEHFVCAFCLKQLNKGTFKEQKDKPYCHTCFDK 578
            :.....||||:.||||     ..:......:|...|.|..|...|....|....::.||..|..|
 Frog   231 SFVAKKCAGCNNPITGFGKGSNVVNYEGNSWHEYCFTCKKCSLNLANKRFVRHNEQVYCQDCAKK 295

  Fly   579 I 579
            :
 Frog   296 M 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830 14/53 (26%)
LIM2_Paxillin_like 407..458 CDD:188723 15/52 (29%)
LIM3_Paxillin_like 466..518 CDD:188724 18/51 (35%)
LIM4_Paxillin 525..576 CDD:188795 16/55 (29%)
fhl1NP_001006703.1 LIM1_FHL1 56..109 CDD:188730 14/52 (27%)
LIM2_FHL1 117..174 CDD:188808 15/56 (27%)
LIM3_FHL1 178..230 CDD:188813 18/51 (35%)
LIM4_FHL1 233..296 CDD:188734 17/62 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.