DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax and stck

DIOPT Version :9

Sequence 1:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster


Alignment Length:320 Identity:87/320 - (27%)
Similarity:130/320 - (40%) Gaps:78/320 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   333 ANMSRQGVNTVQKGCCNACEKPIVGQVITALGKTWHPEHFTCNHCSQELGTRNFFERDGFPYCEP 397
            ||||...::..:  |.:..|.  ..:::.:.|:.||.:.|.|..|.:......|:|.:|..|||.
  Fly    12 ANMSLGAMHCTR--CADGFEP--TEKIVNSNGELWHTQCFVCAQCFRPFQDGIFYEFEGRKYCER 72

  Fly   398 DYHNLFSPRCAYCNGAILDKCVTALDKTWHTEHFFCAQCGQQFGEEGF---------HERDGKP- 452
            |:|.||:|.|..|...::.:.:.|:..:||.:.|.|..|.::..:.||         ||.:.|. 
  Fly    73 DFHVLFAPCCNKCGEFVIGRVIKAMSASWHPQCFRCQLCAKELADCGFIKNQNRALCHECNAKVK 137

  Fly   453 ---------------------------------------------------------------YC 454
                                                                           ||
  Fly   138 AEITGRYVCQKCHGLIDEEPLRFRGEVYHGYHFSCTACGTELDSTAREVKSRPGLAANDMNELYC 202

  Fly   455 RNDYFEMFAPKCNGCNRAIMENYISALNSQWHPDCFVCRDCRQPFQGGSFFDHEGLPYCETHYHA 519
            ...:.:|..|.|..|.|.|.|..::||...||.:.|||..|.:||.|...::..||.|||||||.
  Fly   203 LRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLGHRHYEKRGLAYCETHYHQ 267

  Fly   520 KRGSLCAGCSKPITGRCITAMFKKFHPEHFVCAFC-LKQLNKGTFKEQKDKPYCHTCFDK 578
            ..|:||..|::.|.|...||:.|.:...||.|:.| .|...|..|.|..:||.|..|:|:
  Fly   268 LFGNLCFVCNQVIGGDVFTALNKAWCVHHFACSVCDTKMTQKSKFYEYDEKPVCKKCYDR 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830 14/51 (27%)
LIM2_Paxillin_like 407..458 CDD:188723 15/123 (12%)
LIM3_Paxillin_like 466..518 CDD:188724 23/51 (45%)
LIM4_Paxillin 525..576 CDD:188795 18/51 (35%)
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717 17/61 (28%)
LIM2_PINCH 82..133 CDD:188718 12/50 (24%)
LIM3_PINCH 146..206 CDD:188719 2/59 (3%)
LIM4_PINCH 212..265 CDD:188720 23/52 (44%)
LIM5_PINCH 273..326 CDD:188721 19/52 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I3371
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 1 1.000 - - otm47179
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
65.920

Return to query results.
Submit another query.