DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax and csrp1a

DIOPT Version :9

Sequence 1:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_991130.1 Gene:csrp1a / 378726 ZFINID:ZDB-GENE-030909-4 Length:192 Species:Danio rerio


Alignment Length:211 Identity:48/211 - (22%)
Similarity:78/211 - (36%) Gaps:49/211 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   348 CNACEKPI-VGQVITALGKTWHPEHFTCNHCSQELGTRNFFERDGFPYCEPDYHNLFSPRCAYCN 411
            |..|:|.: ..:.:...|:::|...|.|..|.:.|.:......:...||:..|...:.|: .|..
Zfish     9 CGCCQKTVYFAEEVQCEGRSFHRSCFLCMVCRKNLDSTTVAVHENEIYCKACYGKKYGPK-GYGY 72

  Fly   412 GAILDKCVTALDKTWHTEHFFCAQCGQQFGEEGFHERDGKPYCRNDYFEMFAPK------CNGCN 470
            ||  .....::||            |:..|.:....::.:| ..|.....||.|      |..|:
Zfish    73 GA--GAGTLSMDK------------GESLGIKVVEPQNHQP-TNNPNTSKFAQKFGGSDVCPRCS 122

  Fly   471 RAI--MENYISALNSQWHPDCFVCRDCRQPFQGGSFFDHEGLPYCETHYHAKRGSLCAGCSKPIT 533
            :|:  .|..|.|.|: ||..||.|..|.:..:..:..|.:|..||:            ||     
Zfish   123 KAVYAAEKVIGAGNA-WHRGCFRCAMCGKGLESTTLADKDGEIYCK------------GC----- 169

  Fly   534 GRCITAMFKKFHPEHF 549
                  ..|.|.|:.|
Zfish   170 ------YAKNFGPKGF 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830 11/52 (21%)
LIM2_Paxillin_like 407..458 CDD:188723 9/50 (18%)
LIM3_Paxillin_like 466..518 CDD:188724 17/53 (32%)
LIM4_Paxillin 525..576 CDD:188795 6/25 (24%)
csrp1aNP_991130.1 LIM1_CRP1 7..62 CDD:188863 11/52 (21%)
LIM2_CRP 118..171 CDD:188787 19/76 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.