DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax and Mical2

DIOPT Version :9

Sequence 1:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster
Sequence 2:XP_038941120.1 Gene:Mical2 / 365352 RGDID:1311773 Length:1103 Species:Rattus norvegicus


Alignment Length:480 Identity:92/480 - (19%)
Similarity:150/480 - (31%) Gaps:172/480 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDRTMYGKIDPGARQPYR--------TARSKGIL------PGYALLADLQNSVPGQPQQPQPQYG 51
            |...:..|.:...|.|..        :...|.:|      ||.:....|:.|.|..|...:.|:.
  Rat   716 MANQLLAKFEENTRNPSALKQDCPRVSGMGKPVLCSASRPPGTSHCPKLEESTPRLPPPLKRQFS 780

  Fly    52 TVQPKHQALQQQQFVDNTPGYGSLRGKAQPQVYQEHYSVETRSPTAGHDFNGSSTTPGYANQGSL 116
            :.....|.|::   ::..|..|...|:.        :....:|         .....|..|..:|
  Rat   781 STVATGQVLRE---LNQVPASGECPGRP--------WRARAKS---------DLQLGGAENLATL 825

  Fly   117 PRQAAGASTGLSELDSLLQDLQKIDVPV------NYSTPVSKYNTMNSYATVEER---------- 165
            |....||..    |..:|:.||:::..|      |.:.  .:::|.|    ::|:          
  Rat   826 PPTCQGALA----LSGVLRRLQQVEEKVLQKRAQNLAN--REFHTKN----IKEKAAHLASMFGH 880

  Fly   166 ---PSVDSLLKELDNAHIYAVPNGSAHKSPTPGRHVTITVRETKTEKLTGPDGPVGTVEEQIVQQ 227
               |....|.|.:.:||..:.|  |...||.|.               ..|..|..         
  Rat   881 GDLPQDKLLSKRVPHAHPPSPP--SCLPSPDPA---------------AAPSPPAA--------- 919

  Fly   228 KDSYTPNHAVPGQQVHQAYTSQATKELDDLMASLSDFKVSNGTNGIGNGSHPQQHSSTVQHQTVT 292
             ||.:|                |.|        |:..|||   :|||..:....:.....|:..|
  Rat   920 -DSVSP----------------ARK--------LTVGKVS---SGIGAAAEVLVNLYLNDHRPKT 956

  Fly   293 DYARPNKGSQQAHLTQTIEETTIVEDSREDQLDSMLGNLQANMSRQGVNTVQKGCCNACEKPI-V 356
            ....|:                 :|..|:.:....||.              :..|..|:|.: |
  Rat   957 QATSPD-----------------LESLRKAEFPLSLGG--------------RDTCYFCKKRVYV 990

  Fly   357 GQVITALGKTWHPEHFTCNHCSQELGTRNF-FERD-GFPYCEPDYHNLFSPRCAYCNGAILDKCV 419
            .:.::|.|..:|.|.|.|:.|:..|....: |:.| |..||:..:        |:|         
  Rat   991 MERLSAEGHFFHRECFRCSVCAAILRVAAYAFDCDEGKFYCKLHF--------AHC--------- 1038

  Fly   420 TALDKTWHTEHFFCAQCGQQFGEEG 444
                ||...:....|:..||..|||
  Rat  1039 ----KTSSKQRKRRAELNQQREEEG 1059

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830 17/54 (31%)
LIM2_Paxillin_like 407..458 CDD:188723 10/38 (26%)
LIM3_Paxillin_like 466..518 CDD:188724
LIM4_Paxillin 525..576 CDD:188795
Mical2XP_038941120.1 FAD_binding_3 87..>274 CDD:396193
CH_MICAL2 514..623 CDD:409099
LIM_Mical 981..1035 CDD:188823 17/53 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.