DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax and CG5708

DIOPT Version :9

Sequence 1:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001285799.1 Gene:CG5708 / 34361 FlyBaseID:FBgn0032196 Length:241 Species:Drosophila melanogaster


Alignment Length:248 Identity:54/248 - (21%)
Similarity:85/248 - (34%) Gaps:54/248 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 SHPQQHSSTVQH-QTVTDYARPNKGSQQAHLTQTIEETTIVEDSREDQLDSMLGNLQANMSRQGV 340
            :|.|..||.... ..|.||...|      |...|:|..:.:..|:...:|....:.. |......
  Fly    14 AHHQDSSSPENFAPIVIDYRNSN------HTKDTVETNSNISSSQLSFMDESSNDFN-NQQLIHS 71

  Fly   341 NTVQKGCCNACEKPIVGQVITALGKTWHPEHFTCNHCS---QELGTRNFFERDGFPYCEPDYHNL 402
            |::.|.|....:|.....::.||.:.||.....|:.|.   .|:|: :.|.|.|...|:.||.::
  Fly    72 NSLIKVCGGCGDKISDRYLLYALDRYWHNGCLKCHCCGAMLAEVGS-SCFTRRGLILCKKDYSSM 135

  Fly   403 FSPRCAYCNGAILDKCVTALDKTWHTEHFFCAQCGQQFGEEGFHERDGKPYCRNDYFEMFAPKCN 467
            |.     |:|.                   |:.||:.....                |:.|....
  Fly   136 FG-----CSGV-------------------CSGCGETIPPS----------------ELVAKALT 160

  Fly   468 GCNRAIMEN-YISALNSQWHPDCFVCRDCRQPFQGGSFFDHEGLP-YCETHYH 518
            |.|...::| ....:|..:|..||.|..|....:.|..:...|.. .||..:|
  Fly   161 GINNIDLQNQQKQIINCVFHLRCFSCAKCGSSLRPGDRYTMLGASLVCEQDWH 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830 14/54 (26%)
LIM2_Paxillin_like 407..458 CDD:188723 5/50 (10%)
LIM3_Paxillin_like 466..518 CDD:188724 13/53 (25%)
LIM4_Paxillin 525..576 CDD:188795
CG5708NP_001285799.1 LIM1_LMO4 78..132 CDD:188772 14/54 (26%)
LIM 142..212 CDD:413332 18/85 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 0.796 Domainoid score I4515
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.