Sequence 1: | NP_001033913.1 | Gene: | Pax / 35215 | FlyBaseID: | FBgn0041789 | Length: | 581 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_071946.1 | Gene: | Crip2 / 338401 | RGDID: | 1302959 | Length: | 208 | Species: | Rattus norvegicus |
Alignment Length: | 195 | Identity: | 47/195 - (24%) |
---|---|---|---|
Similarity: | 67/195 - (34%) | Gaps: | 66/195 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 348 CNACEKPI-VGQVITALGKTWHPEHFTCNHCSQELGTRNFFERDGFPYC-EPDYHNLFSPR---- 406
Fly 407 --------------------------------------------------------CAYCNGAI- 414
Fly 415 LDKCVTALDKTWHTEHFFCAQCGQQFGEEGFHERDGKPYCRND-YFEMFAPKCNGCNRAIMENYI 478
Fly 479 478 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Pax | NP_001033913.1 | LIM1_Paxillin_like | 348..400 | CDD:259830 | 17/53 (32%) |
LIM2_Paxillin_like | 407..458 | CDD:188723 | 18/52 (35%) | ||
LIM3_Paxillin_like | 466..518 | CDD:188724 | 4/13 (31%) | ||
LIM4_Paxillin | 525..576 | CDD:188795 | |||
Crip2 | NP_071946.1 | LIM1_TLP | 5..58 | CDD:188860 | 17/52 (33%) |
LIM1_TLP | 126..179 | CDD:188860 | 18/52 (35%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |