DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax and Crip2

DIOPT Version :9

Sequence 1:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_071946.1 Gene:Crip2 / 338401 RGDID:1302959 Length:208 Species:Rattus norvegicus


Alignment Length:195 Identity:47/195 - (24%)
Similarity:67/195 - (34%) Gaps:66/195 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   348 CNACEKPI-VGQVITALGKTWHPEHFTCNHCSQELGTRNFFERDGFPYC-EPDYHNLFSPR---- 406
            |..|:|.: ..:.:::|||.||.....|..|::.|......|.||.|:| :|.|..||.|:    
  Rat     5 CPKCDKTVYFAEKVSSLGKDWHKFCLKCERCNKTLTPGGHAEHDGKPFCHKPCYATLFGPKGVNI 69

  Fly   407 --------------------------------------------------------CAYCNGAI- 414
                                                                    |..||..: 
  Rat    70 GGAGSYIYEKPPTEAPQVTGPIEVPVVRTEERKTSGPPKGPSKASSVTTFTGEPNMCPRCNKRVY 134

  Fly   415 LDKCVTALDKTWHTEHFFCAQCGQQFGEEGFHERDGKPYCRND-YFEMFAPKCNGCNRAIMENYI 478
            ..:.||:|.|.||.....|.:|.:.....|..|.||:|||... |..:|.||  |.|...:.:||
  Rat   135 FAEKVTSLGKDWHRPCLRCERCSKTLTPGGHAEHDGQPYCHKPCYGILFGPK--GVNTGAVGSYI 197

  Fly   479  478
              Rat   198  197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830 17/53 (32%)
LIM2_Paxillin_like 407..458 CDD:188723 18/52 (35%)
LIM3_Paxillin_like 466..518 CDD:188724 4/13 (31%)
LIM4_Paxillin 525..576 CDD:188795
Crip2NP_071946.1 LIM1_TLP 5..58 CDD:188860 17/52 (33%)
LIM1_TLP 126..179 CDD:188860 18/52 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.