DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax and CG31988

DIOPT Version :9

Sequence 1:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001286122.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster


Alignment Length:167 Identity:64/167 - (38%)
Similarity:97/167 - (58%) Gaps:1/167 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   348 CNACEKPIVGQVITALGKTWHPEHFTCNHCSQELGTRNFFERDGFPYCEPDYHNLFSPRCAYCNG 412
            |:.|::.|..::|||||||||||||.|:||.:::....|..:.|.|.|...:...::..||.|..
  Fly     7 CHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGCKK 71

  Fly   413 AILDKCVTALDKTWHTEHFFC-AQCGQQFGEEGFHERDGKPYCRNDYFEMFAPKCNGCNRAIMEN 476
            .||:|.:.|:.::||.:.|.| ..|.:....:.|:||||||||:.||.::||.:|..|.:.|.::
  Fly    72 PILEKTICAMGESWHEDCFCCGGACKKPLANQTFYERDGKPYCKKDYEDLFAARCAKCEKPITDS 136

  Fly   477 YISALNSQWHPDCFVCRDCRQPFQGGSFFDHEGLPYC 513
            .:.|:|.:||.|||.|..|..|....:|......|.|
  Fly   137 AVLAMNVKWHRDCFRCNKCENPITSQTFTIDGDKPVC 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830 23/51 (45%)
LIM2_Paxillin_like 407..458 CDD:188723 21/51 (41%)
LIM3_Paxillin_like 466..518 CDD:188724 16/48 (33%)
LIM4_Paxillin 525..576 CDD:188795
CG31988NP_001286122.1 LIM 7..58 CDD:295319 23/50 (46%)
LIM 66..118 CDD:295319 21/51 (41%)
LIM 126..176 CDD:259829 16/48 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453095
Domainoid 1 1.000 47 0.796 Domainoid score I4515
eggNOG 1 0.900 - - E1_KOG1703
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 1 1.000 - - otm47179
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
76.840

Return to query results.
Submit another query.