DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax and Ablim3

DIOPT Version :9

Sequence 1:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001157963.1 Gene:Ablim3 / 319713 MGIID:2442582 Length:682 Species:Mus musculus


Alignment Length:251 Identity:72/251 - (28%)
Similarity:108/251 - (43%) Gaps:33/251 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   337 RQGVNTVQKGCCNACEKPIVGQVITALGKTWHPEHFTCNHCSQELGTRNFFERDGFPYCEPDYHN 401
            |.|.|.:|   |..|.....|:|:......:|...|||..|...|....||.::....|..||..
Mouse    15 RGGSNVIQ---CYRCGDTCKGEVVRVHNNHFHIRCFTCQVCGCGLAQSGFFFKNQEYICTQDYQQ 76

  Fly   402 LFSPRCAYCNGAILDKCVTALDKTWHTEHFFCAQCGQQF---------GEEGFHERDGKPYCRND 457
            |:..||..|...|..:.::||.:|:|.:.|.|:.|.:.|         |:|...:...:....:.
Mouse    77 LYGTRCDSCRDFITGEVISALGRTYHPKCFVCSLCRKPFPIGDKVTFSGKECVCQTCSQSMTSSK 141

  Fly   458 YFEMFAPK-CNGCNRAIMENY-ISALNSQWHPDCFVCRDCRQPFQGGSFFDHEGLPYCETHYHAK 520
            ..::..|. |.||...|.... :.||:.|||..||.|:.| .....|.:...:|:||||:.||::
Mouse   142 PIKIRGPSHCAGCKEEIKHGQSLLALDKQWHVSCFKCQTC-SVILTGEYISKDGVPYCESDYHSQ 205

  Fly   521 RGSLCAGCSKPITGRCITAMFKKFHPEHFVCAFCLKQLNKGTFKEQKDKPYCHTCF 576
            .|..|..|.:.|:||.:.|..|.:||   .||.|::               ||..|
Mouse   206 FGIKCETCDRYISGRVLEAGGKHYHP---TCARCVR---------------CHQMF 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830 14/51 (27%)
LIM2_Paxillin_like 407..458 CDD:188723 13/59 (22%)
LIM3_Paxillin_like 466..518 CDD:188724 19/52 (37%)
LIM4_Paxillin 525..576 CDD:188795 14/50 (28%)
Ablim3NP_001157963.1 LIM1_abLIM 23..74 CDD:188713 13/50 (26%)
LIM2_abLIM 79..134 CDD:188714 14/54 (26%)
LIM3_abLIM 151..202 CDD:188715 19/51 (37%)
LIM4_abLIM 210..265 CDD:188716 15/52 (29%)
AbLIM_anchor 273..645 CDD:374416
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 372..426
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 440..475
VHP 647..682 CDD:128458
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.