DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax and Synpo2l

DIOPT Version :9

Sequence 1:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001292067.1 Gene:Synpo2l / 305675 RGDID:1565434 Length:978 Species:Rattus norvegicus


Alignment Length:342 Identity:79/342 - (23%)
Similarity:113/342 - (33%) Gaps:102/342 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IDPGARQPYRTAR-----------SKGILPGYALLADLQNSVPGQP--QQPQPQYGTVQPKHQAL 60
            ||....|...|.|           |.|.|...:.|:.|....||.|  |.|||            
  Rat    73 IDASGHQLVLTVRRVAEEGSVRSPSPGELQMLSPLSPLSPEPPGAPVTQAPQP------------ 125

  Fly    61 QQQQFVDNTPGYGSLRGKAQPQVYQEHYSVETRSPTAGHDFNGSST--TPGYANQGSLPRQAAGA 123
                        ||||.....:.|   |. ||.|     |.:|.:|  .|....:...||.:.  
  Rat   126 ------------GSLRSPPDSEAY---YG-ETDS-----DVDGPATHEKPRRTRRRGPPRPSL-- 167

  Fly   124 STGLSELDSLLQDLQKIDVPVNYSTPVSKYNTMNSYATVE----ERPSVDSLLKELDNAHIYAVP 184
             .|....:..|.|......||...:|....:.::|.:..|    :.|..::||          :|
  Rat   168 -PGAPPDEVYLSDSPAEPAPVKTGSPSQGDSRVSSPSWEEGSALQPPPAEALL----------LP 221

  Fly   185 NGSAHKSPTPGRHVTITVRETKTEKLTGPDGPV-GTVEEQIVQQKDSYTPNHAVPGQQVHQAYTS 248
            :|...    ||.|:...|            ||| ..|.|.:.   .:||       |:..||...
  Rat   222 HGPLR----PGPHLIPMV------------GPVPHPVAEDLT---TTYT-------QKAKQAKLQ 260

  Fly   249 QATKELDDLMASLSDFKVSNGTNGIGNGSHPQQHSSTV-----QHQTVTDYARPNKGSQQAHLTQ 308
            :| :.|.:  .|:.:.|....|......:.|..||..|     :.|....|...:.|:  |..|.
  Rat   261 RA-ESLQE--KSVKEAKTKCRTIASLLTAAPNPHSKGVLMFKKRRQRAKKYTLVSFGA--AAGTG 320

  Fly   309 TIEETTIVEDSREDQLD 325
            |.||...:..:.|.:||
  Rat   321 TEEEEDGIPPTSESELD 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830
LIM2_Paxillin_like 407..458 CDD:188723
LIM3_Paxillin_like 466..518 CDD:188724
LIM4_Paxillin 525..576 CDD:188795
Synpo2lNP_001292067.1 PDZ_signaling 6..85 CDD:238492 4/11 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.