DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax and Mical1

DIOPT Version :9

Sequence 1:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster
Sequence 2:XP_038954550.1 Gene:Mical1 / 294520 RGDID:1309386 Length:1058 Species:Rattus norvegicus


Alignment Length:289 Identity:57/289 - (19%)
Similarity:84/289 - (29%) Gaps:101/289 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KIDPGARQP---------------YRTARSK-GILPG---------------YALLADLQNSVPG 41
            ::.||..:|               .|.|..: ||:|.               .|.|:...::...
  Rat   548 RLQPGLLEPSELQGMSALEATAWALRVAEYELGIIPVLSAQAVVAGSDPLGLIAYLSHFHSAFKN 612

  Fly    42 QPQQPQPQYGTVQPKHQALQQQQFVDNTPGYGSLRGKAQPQVYQEHYSVETRSP-TAGHDFNGSS 105
            .|...    |.|...|          .||......||.|..:.:....||..:| |.....:..|
  Rat   613 TPHSS----GLVSQPH----------GTPSAILFLGKLQRSLQRTRTKVEEETPCTEEPPVSEPS 663

  Fly   106 TTPGYANQGSLPRQAAGASTGLSELDSLLQDLQKIDV--------------------PVNYSTPV 150
            ..|...::    .:.|||..........|..|::..|                    |..|    
  Rat   664 VPPALPSE----HEEAGAEDVCELCGKRLYILERFCVDGHFFHRGCFCCRTCEATLRPGGY---- 720

  Fly   151 SKYNTMNSYATVEERPSVDSLLKELDNAHIYAVPNGSAHKS--PTPGRHVTITVRETKTEKLTGP 213
            .:|.....:..::..|..|.  ||.||       |||....  ||||...|          .:||
  Rat   721 GQYPGDGYFYCLQHLPQEDQ--KEADN-------NGSPENQELPTPGDSTT----------QSGP 766

  Fly   214 DGPVGTVEEQIVQQKDSYTPNHAVPGQQV 242
            ..||..|.|.      |..|:.:.|.:::
  Rat   767 SSPVPPVTEA------SPVPSPSQPARRL 789

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830
LIM2_Paxillin_like 407..458 CDD:188723
LIM3_Paxillin_like 466..518 CDD:188724
LIM4_Paxillin 525..576 CDD:188795
Mical1XP_038954550.1 FAD_binding_3 85..>122 CDD:396193
CH_MICAL1 506..611 CDD:409045 10/62 (16%)
LIM 681..734 CDD:413332 6/56 (11%)
DUF3585 929..1056 CDD:403377
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.