DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax and Arhgap28

DIOPT Version :9

Sequence 1:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster
Sequence 2:XP_036016523.1 Gene:Arhgap28 / 268970 MGIID:2147003 Length:756 Species:Mus musculus


Alignment Length:368 Identity:68/368 - (18%)
Similarity:117/368 - (31%) Gaps:142/368 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PQYGTVQPKHQALQQQQFVDNTPGYGSLRGKAQPQVYQEHYSVETRSPTA-GH--------DFNG 103
            |..|..:|..:||.::..           |.|.|.....|..:...|..| ||        |..|
Mouse    12 PLGGRGRPSRRALGRRTL-----------GAADPLPELVHVGLGLCSGLARGHAPLRMEVEDSGG 65

  Fly   104 SSTTPGYAN-----QGSLPRQAAGASTGLS--------ELDSLLQDLQKIDVPVNYSTPVSKYNT 155
            ...|..:::     ||:.||.|:.||..||        .::.:|.         |.|.....::.
Mouse    66 VVLTAYHSHARSQPQGAEPRCASRASHPLSRKSIPRCRRINRMLS---------NESLHPPSFSR 121

  Fly   156 MNSYATVEERPSVDSLLKELDNAHIYAVPNGSAHKSPTPGRHVTITVRETKTEKLTGPDGPVGTV 220
            .||.|:|:...|::..|:|::                        :::|:.          ||..
Mouse   122 SNSQASVDSSASMEEFLREIE------------------------SIKESS----------VGAS 152

  Fly   221 EEQIVQQKDSYTPNHAVPGQQVHQAYTSQATKELDDLMASLSDFKVSNGTNGIGNGSHPQQHSST 285
            :||        .|..|....:|         |.:|:                             
Mouse   153 QEQ--------PPTAAAAAAEV---------KPVDE----------------------------- 171

  Fly   286 VQHQTVTDYARPNKGSQQAHLTQTIEETTIVEDSREDQLDSMLGNL---QANMSRQGVNTVQKGC 347
                          |..:|...|.:..:|::..:.|:...::|..|   ||...::..||..:..
Mouse   172 --------------GELEAEWLQDVGLSTLISGNEEEDGKALLSTLTRTQAAAVKKRYNTYTQTL 222

  Fly   348 CNACEKPIVGQVITALGKTWHPEHFTCNHCSQELGTRNFFERD 390
            ....::| |..|....|.:..|...:|.|.:|..||:.  |:|
Mouse   223 RKKNKQP-VRDVRDIFGVSESPPSDSCEHATQLDGTKE--EKD 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830 12/43 (28%)
LIM2_Paxillin_like 407..458 CDD:188723
LIM3_Paxillin_like 466..518 CDD:188724
LIM4_Paxillin 525..576 CDD:188795
Arhgap28XP_036016523.1 RhoGAP_ARHGAP18 408..619 CDD:239856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1093
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.