DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax and LHX6

DIOPT Version :9

Sequence 1:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster
Sequence 2:XP_011516823.1 Gene:LHX6 / 26468 HGNCID:21735 Length:407 Species:Homo sapiens


Alignment Length:147 Identity:38/147 - (25%)
Similarity:58/147 - (39%) Gaps:30/147 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   395 CEPDYHNLFSPR-------------CAYCNGAILDKCVTALDK-TWHTEHFFCAQCGQQFGEE-G 444
            |.|...::.||.             |:.|...|||:.:..::. .||.....|:.|.....:: .
Human    74 CTPSTPSVCSPPSAASSVPSAGKNICSSCGLEILDRYLLKVNNLIWHVRCLECSVCRTSLRQQNS 138

  Fly   445 FHERDGKPYCRNDYFEMFAPKCNGCNRAIMENYIS-----ALNSQWHPDCFVCRDCRQPFQGGSF 504
            .:.::.:.:|:.|||..|..||..|.|.|   |.|     |..:.:|..||.|..|::....|..
Human   139 CYIKNKEIFCKMDYFSRFGTKCARCGRQI---YASDWVRRARGNAYHLACFACFSCKRQLSTGEE 200

  Fly   505 FDHEGL----PYCETHY 517
            |   ||    ..|..||
Human   201 F---GLVEEKVLCRIHY 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830 2/4 (50%)
LIM2_Paxillin_like 407..458 CDD:188723 10/52 (19%)
LIM3_Paxillin_like 466..518 CDD:188724 19/61 (31%)
LIM4_Paxillin 525..576 CDD:188795
LHX6XP_011516823.1 LIM1_Lhx6 99..152 CDD:188766 10/52 (19%)
LIM2_Lhx6 160..214 CDD:188768 17/59 (29%)
Homeobox 252..304 CDD:278475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.