DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax and rga1

DIOPT Version :9

Sequence 1:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_596743.1 Gene:rga1 / 2541022 PomBaseID:SPBC3F6.05 Length:1150 Species:Schizosaccharomyces pombe


Alignment Length:311 Identity:82/311 - (26%)
Similarity:130/311 - (41%) Gaps:74/311 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 SPTPGRHVTITVRETKTEKLTGPDGPVGTVEEQIVQQKDSYTPNHAVPGQQVHQAYTSQATKELD 255
            ||||.:.:.:..|:.|.|                   ::|.|.|..      |..:||...    
pombe    19 SPTPPKRIPVPSRQNKIE-------------------ENSTTKNFP------HSRHTSTVA---- 54

  Fly   256 DLMASLSDFKVSNGTNGIGNGSHPQQHSSTVQHQTVTDYARPNKGSQQAHLTQTIEETTIVEDSR 320
                         ||.  |..|..::|:|....:     |.||:        |.:.::.::  ::
pombe    55 -------------GTE--GGSSLSRRHTSAESRK-----ALPNQ--------QQLAQSGLL--NK 89

  Fly   321 EDQLDSMLGNLQANMSRQGVNTVQKG-CCNACEKPIVGQVITALGKTWHPEHFTCNHCSQELGTR 384
            |:|  ..|.....::..:.|..|... .|.:|.:.|.||.:.|||..:|.|.|.|:.|:..:.::
pombe    90 EEQ--QSLKRSDTSVFPKAVRKVSSSKICASCGQVISGQYVRALGNIYHLECFRCHDCNSLVASK 152

  Fly   385 NFFERDG------FPYCEPDYHNLFSPRCAYCNGAILDKCVTALDKTWHTEHFFCAQCGQQFG-E 442
             ||..|.      .|.||.||.......||.|..|:....:|||:|.:|.|||.|:.|...|| .
pombe   153 -FFPIDDPTLNKQVPLCETDYFRRLDLLCASCGMALRGYYITALNKKFHIEHFTCSLCYTVFGPN 216

  Fly   443 EGFHERDGKPYCRNDYFEMFAPKCNGCN----RAIMENYISALNSQWHPDC 489
            :.::|.:||.||...|..:||.:|.||:    |..:|.|.:.::..||..|
pombe   217 DSYYEYEGKVYCHYHYSTLFAARCCGCDGPILRQFVEVYRNGVSQNWHVPC 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830 20/57 (35%)
LIM2_Paxillin_like 407..458 CDD:188723 21/51 (41%)
LIM3_Paxillin_like 466..518 CDD:188724 9/28 (32%)
LIM4_Paxillin 525..576 CDD:188795
rga1NP_596743.1 LIM1_Lrg1p_like 116..172 CDD:188777 19/56 (34%)
LIM2_Lrg1p_like 180..232 CDD:188778 21/51 (41%)
LIM 485..539 CDD:295319
RhoGAP_fLRG1 835..1044 CDD:239862
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 49 1.000 Domainoid score I3455
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 1 1.000 - - otm47179
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1093
SonicParanoid 1 1.000 - - X39
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.