DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax and FHL2

DIOPT Version :9

Sequence 1:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001034581.1 Gene:FHL2 / 2274 HGNCID:3703 Length:279 Species:Homo sapiens


Alignment Length:215 Identity:66/215 - (30%)
Similarity:100/215 - (46%) Gaps:4/215 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   370 EHFTCNHCSQELGTRNFFERDGFPYCEPDYHNLFSPRCAYCNGAILDKC--VTALDKTWHTEHFF 432
            |.|.|:||::.|..:.:..|:..|||...:..||:..|..|...|...|  ::..|:.||...|.
Human     3 ERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFH 67

  Fly   433 CAQCGQQFGEEGFHERDGKPYCRNDYFEMFAPKCNGCNRAIM--ENYISALNSQWHPDCFVCRDC 495
            |:||.....::.|..::.:..|.:.|...::.||..|.:.||  ...:....|.||..||:|..|
Human    68 CSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRC 132

  Fly   496 RQPFQGGSFFDHEGLPYCETHYHAKRGSLCAGCSKPITGRCITAMFKKFHPEHFVCAFCLKQLNK 560
            :||....||...:...:|...|..:....|..|.||||...:|...:.:|.|.|||..|.|||:.
Human   133 QQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSG 197

  Fly   561 GTFKEQKDKPYCHTCFDKIF 580
            ..|..:.|..||..||..::
Human   198 QRFTARDDFAYCLNCFCDLY 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830 10/29 (34%)
LIM2_Paxillin_like 407..458 CDD:188723 13/52 (25%)
LIM3_Paxillin_like 466..518 CDD:188724 16/53 (30%)
LIM4_Paxillin 525..576 CDD:188795 20/50 (40%)
FHL2NP_001034581.1 LIM <5..33 CDD:413332 9/27 (33%)
LIM1_FHL2 36..97 CDD:188806 15/60 (25%)
LIM2_FHL2 101..157 CDD:188810 17/55 (31%)
LIM3_Fhl2 162..218 CDD:188815 22/56 (39%)
LIM4_FHL2 221..278 CDD:188817
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.