DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax and Y65B4A.7

DIOPT Version :9

Sequence 1:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_490764.1 Gene:Y65B4A.7 / 190486 WormBaseID:WBGene00022030 Length:156 Species:Caenorhabditis elegans


Alignment Length:133 Identity:37/133 - (27%)
Similarity:51/133 - (38%) Gaps:25/133 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   405 PRCAYCNGAILDKCVTAL--------------DKTWHTEHFFCAQCGQQFGEEGFHERDGKPY-- 453
            |...:|.|     |.|.|              |:.:|.....|:.|....|....:.... ||  
 Worm    16 PYNIHCKG-----CTTTLTRQEAQTGKVIKIQDEMYHISCLKCSVCQTVIGMTPCYPMPA-PYGN 74

  Fly   454 ---CRNDYFEMFAPKCNGCNRAIMENYISALNSQWHPDCFVCRDCRQPFQGGSFFDHEGLPYCET 515
               |.:.:....:|||:.|.....|..:||.|..||..||.|:.||.|.:|..:..|:|..|.|.
 Worm    75 ALRCADCHRAAKSPKCHACKLPTFERCVSAFNVHWHMACFKCKACRHPIKGQEYVVHQGCAYDED 139

  Fly   516 HYH 518
            .||
 Worm   140 CYH 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830
LIM2_Paxillin_like 407..458 CDD:188723 13/69 (19%)
LIM3_Paxillin_like 466..518 CDD:188724 19/51 (37%)
LIM4_Paxillin 525..576 CDD:188795
Y65B4A.7NP_490764.1 LIM_DA1 90..141 CDD:188782 19/50 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.