DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Pax and F33D11.1

DIOPT Version :9

Sequence 1:	NP_001033913.1	Gene:	Pax / 35215	FlyBaseID:	FBgn0041789	Length:	581	Species:	Drosophila melanogaster
Sequence 2:	NP_491698.1	Gene:	F33D11.1 / 185224	WormBaseID:	WBGene00018000	Length:	131	Species:	Caenorhabditis elegans

Alignment Length:	139	Identity:	36/139 - (25%)
Similarity:	49/139 - (35%)	Gaps:	37/139 - (26%)

- Green bases have known domain annotations that are detailed below.

  Fly   374 CNHCSQELGTRNFFERDGFPYCEPDYHNLFSPRCAYCNGAILDKCVTALDKTWHTEHFFCAQCGQ 438
            |.|||.::|..:....:|                                |.||..|..|..|..
Worm     4 CGHCSVKVGEESAILTNG--------------------------------KVWHVNHLLCDLCNC 36

  Fly   439 QFGE-EGFHERDGKPYCRNDYFEMFAPKCNGCNRAIMENYISALNSQWHPDCFVCRDCRQPFQGG 502
            :..: |....::|...|...:.:...|.|.||...|..|...||||.|||.||.|..|::|.:
Worm    37 RINDGERCVPQNGVILCSECHIKTTRPICKGCGEFIKTNLCEALNSTWHPTCFQCSVCQKPLE-- 99

  Fly   503 SFFDHEGLP 511
              .|...||
Worm   100 --VDFHQLP 106

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Pax	NP_001033913.1	LIM1_Paxillin_like	348..400	CDD:259830	6/25 (24%)
		LIM2_Paxillin_like	407..458	CDD:188723	9/51 (18%)
		LIM3_Paxillin_like	466..518	CDD:188724	20/46 (43%)
		LIM4_Paxillin	525..576	CDD:188795
F33D11.1	NP_491698.1	LIM	4..57	CDD:295319	15/84 (18%)
F33D11.1	NP_491698.1	LIM	65..>97	CDD:295319	16/31 (52%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1703
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000055
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	3	2.810