| Sequence 1: | NP_001033913.1 | Gene: | Pax / 35215 | FlyBaseID: | FBgn0041789 | Length: | 581 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_741435.2 | Gene: | prkl-1 / 177463 | WormBaseID: | WBGene00022727 | Length: | 523 | Species: | Caenorhabditis elegans |
| Alignment Length: | 195 | Identity: | 53/195 - (27%) |
|---|---|---|---|
| Similarity: | 74/195 - (37%) | Gaps: | 39/195 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 348 CNACEKPI----VGQVITALGKTWHPEHFTCNHCSQELGTRNFFERDGFPYCEPDYHNLFSPRCA 408
Fly 409 YCNGAIL-DKCVTALDKTWHTEHFFCAQCGQQFGEEGFHERDGKPYCRNDYFEMFAPKCNGCNRA 472
Fly 473 IMENYISALNSQWH--PDCFVCRDCRQPFQGGSFFDHEGLPYCETHYHAKRGSL-CAGCSKPITG 534
Fly 535 534 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Pax | NP_001033913.1 | LIM1_Paxillin_like | 348..400 | CDD:259830 | 15/55 (27%) |
| LIM2_Paxillin_like | 407..458 | CDD:188723 | 19/51 (37%) | ||
| LIM3_Paxillin_like | 466..518 | CDD:188724 | 9/53 (17%) | ||
| LIM4_Paxillin | 525..576 | CDD:188795 | 5/10 (50%) | ||
| prkl-1 | NP_741435.2 | PET_Prickle | 48..144 | CDD:193602 | |
| LIM1_Testin_like | 149..204 | CDD:188726 | 15/54 (28%) | ||
| LIM2_Testin_like | 210..262 | CDD:188727 | 21/60 (35%) | ||
| LIM | 283..324 | CDD:295319 | 9/34 (26%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X39 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.910 | |||||