DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax and Y1A5A.1

DIOPT Version :9

Sequence 1:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_497801.1 Gene:Y1A5A.1 / 175515 WormBaseID:WBGene00012379 Length:192 Species:Caenorhabditis elegans


Alignment Length:179 Identity:49/179 - (27%)
Similarity:84/179 - (46%) Gaps:20/179 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 PIVGQVITALGKTWHPEHFTCN-HCSQELGTRNFFERDGFPYCEPDYHNLFSPRCAYCNGAILDK 417
            |::.|.|    ..:||:..||. ..|:.:.|..|:..     |:....::....|.:|:.:|..:
 Worm    22 PLLCQYI----PRYHPQMPTCPLFESKSIITPVFYFN-----CKRMDRSIDRRLCGHCHQSIGSE 77

  Fly   418 CVTALDKTWHTEHFFCAQCGQQFGEEGFHERDGKPYCRNDYFEMFAPKCNGCNRAIMENYISALN 482
            .:.|:::.||.:||.|:.|.:.. ::.|...|...||...:.:.:.|||.||...:::..:.||:
 Worm    78 ALVAMNRLWHPDHFTCSSCKRPI-KQTFQAADNHAYCVQCFAQKYNPKCAGCMETLVDTCLLALD 141

  Fly   483 SQWHPDCFVCRDCRQPFQGGSFFDHEGLPY---C------ETHYHAKRG 522
            ..|||.||.|..|.:|...|.|:..:..||   |      |...|.:||
 Worm   142 RHWHPRCFTCSSCNRPLPNGEFYLVDDKPYDLDCHWAKRLEKREHMERG 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830 11/46 (24%)
LIM2_Paxillin_like 407..458 CDD:188723 14/50 (28%)
LIM3_Paxillin_like 466..518 CDD:188724 19/60 (32%)
LIM4_Paxillin 525..576 CDD:188795
Y1A5A.1NP_497801.1 LIM 67..117 CDD:295319 14/50 (28%)
LIM_DA1 125..176 CDD:188782 17/50 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.