Sequence 1: | NP_001033913.1 | Gene: | Pax / 35215 | FlyBaseID: | FBgn0041789 | Length: | 581 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_497801.1 | Gene: | Y1A5A.1 / 175515 | WormBaseID: | WBGene00012379 | Length: | 192 | Species: | Caenorhabditis elegans |
Alignment Length: | 179 | Identity: | 49/179 - (27%) |
---|---|---|---|
Similarity: | 84/179 - (46%) | Gaps: | 20/179 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 354 PIVGQVITALGKTWHPEHFTCN-HCSQELGTRNFFERDGFPYCEPDYHNLFSPRCAYCNGAILDK 417
Fly 418 CVTALDKTWHTEHFFCAQCGQQFGEEGFHERDGKPYCRNDYFEMFAPKCNGCNRAIMENYISALN 482
Fly 483 SQWHPDCFVCRDCRQPFQGGSFFDHEGLPY---C------ETHYHAKRG 522 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Pax | NP_001033913.1 | LIM1_Paxillin_like | 348..400 | CDD:259830 | 11/46 (24%) |
LIM2_Paxillin_like | 407..458 | CDD:188723 | 14/50 (28%) | ||
LIM3_Paxillin_like | 466..518 | CDD:188724 | 19/60 (32%) | ||
LIM4_Paxillin | 525..576 | CDD:188795 | |||
Y1A5A.1 | NP_497801.1 | LIM | 67..117 | CDD:295319 | 14/50 (28%) |
LIM_DA1 | 125..176 | CDD:188782 | 17/50 (34%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1703 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1593918at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000055 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.820 |