DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Pax and Lhx9

DIOPT Version :9

Sequence 1:	NP_001033913.1	Gene:	Pax / 35215	FlyBaseID:	FBgn0041789	Length:	581	Species:	Drosophila melanogaster
Sequence 2:	NP_001036042.1	Gene:	Lhx9 / 16876	MGIID:	1316721	Length:	397	Species:	Mus musculus

Alignment Length:	136	Identity:	44/136 - (32%)
Similarity:	61/136 - (44%)	Gaps:	11/136 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly   389 RD-GFPYCEPDYHNLFSPRCAYCNGAILDK-CVTALDKTWHTEHFFCAQCGQQFGEE-GFHERDG 450
            || |.|...|:...|    ||.|.|.|.|: .:.|:||.||.....|.:|......| ....:||
Mouse    56 RDAGMPPLSPEKPAL----CAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDG 116

  Fly   451 KPYCRNDYFEMFA-PKCNGCNRAI--MENYISALNSQWHPDCFVCRDCRQPFQGGSFFD-HEGLP 511
            ..||:.||:..|: .:|..|:..|  .|..:.|.:|.:|..||.|..|.:....|..|. .:.|.
Mouse   117 SIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDSVYHLSCFTCSTCNKTLTTGDHFGMKDSLV 181

  Fly   512 YCETHY 517
            ||..|:
Mouse   182 YCRAHF 187

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Pax	NP_001033913.1	LIM1_Paxillin_like	348..400	CDD:259830	5/11 (45%)
		LIM2_Paxillin_like	407..458	CDD:188723	18/52 (35%)
		LIM3_Paxillin_like	466..518	CDD:188724	17/55 (31%)
		LIM4_Paxillin	525..576	CDD:188795
Lhx9	NP_001036042.1	LIM1_Lhx2	61..124	CDD:188853	21/66 (32%)
		LIM2_Lhx2_Lhx9	129..187	CDD:188763	16/57 (28%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	248..272
		Homeobox	271..323	CDD:278475
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	330..365
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	378..397
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910