DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax and PRICKLE2

DIOPT Version :9

Sequence 1:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster
Sequence 2:XP_011531734.1 Gene:PRICKLE2 / 166336 HGNCID:20340 Length:966 Species:Homo sapiens


Alignment Length:367 Identity:91/367 - (24%)
Similarity:140/367 - (38%) Gaps:76/367 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 PNGSAHK-------SPTPGRHVTITVRETKTEKL------------TGPDGPVGTVEEQIVQQKD 229
            |..:.||       ...|.....:||...:.||.            |..|.....:||.      
Human    71 PGFALHKWRKICLHCKCPQEEHMVTVMPLEMEKTISKLMFDFQRNSTSDDDSGCALEEY------ 129

  Fly   230 SYTPNHAVPG---QQVHQAYTSQATKELDDLMASLSDFKVSNGTNGIGNGSHPQQHSSTVQHQTV 291
            ::.|    ||   :||||.|            :.|.:.||.. .|..|.....:|    :.||  
Human   130 AWVP----PGLKPEQVHQYY------------SCLPEEKVPY-VNSPGEKLRIKQ----LLHQ-- 171

  Fly   292 TDYARPNKGSQQAHLTQTIEETTIVEDSREDQLDSMLGNLQANMSRQGVN----TVQKGCCNACE 352
               ..|:  ..:.....:::|    |:.||.:|.|. ...:.|:.|..|.    |:....|..|.
Human   172 ---LPPH--DNEVRYCNSLDE----EEKRELKLFSS-QRKRENLGRGNVRPFPVTMTGAICEQCG 226

  Fly   353 KPIVGQVITAL------GKTWHPEHFTCNHCSQELGTRNFFERDGFPYCEPDYHNLFSPRCAYCN 411
            ..|.|..|...      |..|||..|.|..|::.|....:|.:||..||...:.....||||.|:
Human   227 GQINGGDIAVFASRAGHGVCWHPPCFVCTVCNELLVDLIYFYQDGKIYCGRHHAECLKPRCAACD 291

  Fly   412 GAIL-DKCVTALDKTWHTEHFFCAQCGQQFGEEGFHERDGKPYCRNDYFEMFAPKCNGCNR--AI 473
            ..|. |:|..|..:.||.:||.|.:|....|.:.:..::|:|||.:.:..::|..|:.|.:  .|
Human   292 EIIFADECTEAEGRHWHMKHFCCFECETVLGGQRYIMKEGRPYCCHCFESLYAEYCDTCAQHIGI 356

  Fly   474 MENYISALNSQWH--PDCFVCRDCRQPFQGGSFFDHEGLPYC 513
            .:..::.....||  ..||.|..|::...|..|...:|..:|
Human   357 DQGQMTYDGQHWHATETCFCCAHCKKSLLGRPFLPKQGQIFC 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830 18/57 (32%)
LIM2_Paxillin_like 407..458 CDD:188723 18/51 (35%)
LIM3_Paxillin_like 466..518 CDD:188724 13/52 (25%)
LIM4_Paxillin 525..576 CDD:188795
PRICKLE2XP_011531734.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.