DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax and PRICKLE1

DIOPT Version :9

Sequence 1:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001138353.1 Gene:PRICKLE1 / 144165 HGNCID:17019 Length:831 Species:Homo sapiens


Alignment Length:213 Identity:57/213 - (26%)
Similarity:87/213 - (40%) Gaps:18/213 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 SREDQLDSMLGNLQANMSRQGVNT-------VQKGCCNACEKPIVGQVITAL------GKTWHPE 370
            |.|::.:..:.:.|......|..|       |....|..|...|.|..:...      |..|||.
Human    90 SEEEKKELQVFSAQRKKEALGRGTIKLLSRAVMHAVCEQCGLKINGGEVAVFASRAGPGVCWHPS 154

  Fly   371 HFTCNHCSQELGTRNFFERDGFPYCEPDYHNLFSPRCAYCNGAIL-DKCVTALDKTWHTEHFFCA 434
            .|.|..|::.|....:|.:||..:|...:..|..|||:.|:..|. |:|..|..:.||.:||.|.
Human   155 CFVCFTCNELLVDLIYFYQDGKIHCGRHHAELLKPRCSACDEIIFADECTEAEGRHWHMKHFCCL 219

  Fly   435 QCGQQFGEEGFHERDGKPYCRNDYFEMFAPKCNGCNRAIMENYISAL--NSQWHPD--CFVCRDC 495
            :|....|.:.:..:||:|:|...:..::|..|..|...|..::....  ...||..  ||.|..|
Human   220 ECETVLGGQRYIMKDGRPFCCGCFESLYAEYCETCGEHIGVDHAQMTYDGQHWHATEACFSCAQC 284

  Fly   496 RQPFQGGSFFDHEGLPYC 513
            :....|..|...:|..||
Human   285 KASLLGCPFLPKQGQIYC 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830 16/57 (28%)
LIM2_Paxillin_like 407..458 CDD:188723 17/51 (33%)
LIM3_Paxillin_like 466..518 CDD:188724 14/52 (27%)
LIM4_Paxillin 525..576 CDD:188795
PRICKLE1NP_001138353.1 PET_Prickle 22..118 CDD:193602 5/27 (19%)
LIM1_Prickle_1 126..184 CDD:188867 16/57 (28%)
LIM2_Prickle 189..244 CDD:188802 19/54 (35%)
LIM3_Prickle 249..307 CDD:188804 14/54 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 313..342
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 663..688
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 763..831
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.