DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax and AgaP_AGAP008979

DIOPT Version :9

Sequence 1:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster
Sequence 2:XP_319729.4 Gene:AgaP_AGAP008979 / 1279942 VectorBaseID:AGAP008979 Length:271 Species:Anopheles gambiae


Alignment Length:184 Identity:49/184 - (26%)
Similarity:66/184 - (35%) Gaps:50/184 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 CNHCSQELGT----RNFFERDGFPYCEPDYHNLFS-PRCAYCNGAI--LDKCVTALDKTWHTEHF 431
            |..|.:.|.|    .:.:.|:|..||:.||:..|| .|||.|...|  .|..:.|.|..:|...|
Mosquito     3 CLRCCKCLHTLEAELSCYSREGNIYCKDDY
YRHFSVRRCARCGNGISASDLVMRAKDLIFHVNCF 67

  Fly   432 FCAQCGQQF-GEEGFHERDGKPYC---RNDYFEMFAPKCNGCNRAIMENYISALNSQ-----WHP 487
            .|..|||.. |.:....|||:.:|   ..:......|...|.|....::....|..|     || 
Mosquito    68 SCLICGQLLRGGDTAGIRDGRVFC
GKLPTNRARRQTPNRGGANPPGRQSTHGLLPGQVCHLLWH- 131

  Fly   488 DCFVCRDCRQPFQGGSFFDHEGLP-----------YCETHYHAKRGSLCAGCSK 530
                             |:|..:|           ||     ||.|||...|.:
Mosquito   132 -----------------FNHVSIPGAHIRSPPRWNYC-----AKDGSLHCDCRR 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830 9/29 (31%)
LIM2_Paxillin_like 407..458 CDD:188723 18/56 (32%)
LIM3_Paxillin_like 466..518 CDD:188724 11/67 (16%)
LIM4_Paxillin 525..576 CDD:188795 1/6 (17%)
AgaP_AGAP008979XP_319729.4 LIM <1..32 CDD:295319 8/28 (29%)
LIM 37..91 CDD:295319 19/53 (36%)
HOX 224..270 CDD:197696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.