DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax and AgaP_AGAP010209

DIOPT Version :9

Sequence 1:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster
Sequence 2:XP_319393.4 Gene:AgaP_AGAP010209 / 1279631 VectorBaseID:AGAP010209 Length:451 Species:Anopheles gambiae


Alignment Length:136 Identity:47/136 - (34%)
Similarity:63/136 - (46%) Gaps:13/136 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   407 CAYCNGAILDKCV--TALDKTWHTEHFFCAQCGQQFGEEG--FHERDGKPYCRNDYFEMFAPKCN 467
            |..|.|.|.|:.:  .|.|..||.....|.:| :||.:|.  ...||||.||:.||..:|..||:
Mosquito    56 CVGCGGQIHDQYILRVAPDLEWHAACLKCQEC-RQFLDESCTCFVRDGKTYCKRDYVRLFGTKCD 119

  Fly   468 GCNRAIMEN--YISALNSQWHPDCFVCRDC-RQPFQGGSFFDHE-GLPYC-ETHYHAKRGS---L 524
            .|..:..:|  .:.|....:|.:||.|..| ||...|..|...: |..|| |.|.|.::.|   |
Mosquito   120 KCGSSFSKNDFVMRAKTKIYHIECFRCSACARQLIPGDEFALRDGGSLYCKEDHDHLEKSSQNGL 184

  Fly   525 CAGCSK 530
            ..|..|
Mosquito   185 VQGAGK 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830
LIM2_Paxillin_like 407..458 CDD:188723 20/54 (37%)
LIM3_Paxillin_like 466..518 CDD:188724 18/56 (32%)
LIM4_Paxillin 525..576 CDD:188795 2/6 (33%)
AgaP_AGAP010209XP_319393.4 LIM1_Isl 56..110 CDD:188752 20/54 (37%)
LIM2_Isl 118..173 CDD:188760 17/54 (31%)
COG5576 196..>318 CDD:227863
HOX 244..300 CDD:197696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.