DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax and AgaP_AGAP006540

DIOPT Version :9

Sequence 1:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster
Sequence 2:XP_316578.4 Gene:AgaP_AGAP006540 / 1277139 VectorBaseID:AGAP006540 Length:334 Species:Anopheles gambiae


Alignment Length:155 Identity:49/155 - (31%)
Similarity:66/155 - (42%) Gaps:22/155 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   326 SMLGNLQANMSRQGVNTVQKGCCNACEKPIVGQVITALGK-TWHPEHFTCNHCSQELGTR-NFFE 388
            |:.|..||....:.        |.||.:||..|.:..:|. :||.....|..|...|..: :.|.
Mosquito     9 SLSGQCQAPKELRS--------CTACGEPISDQFLLDVGGCSWHSACLRCCICHTPLDHQPSCFL 65

  Fly   389 RDGFPYCEPDYHNLFSPRCAYCNGAI--LDKCVTALDKTWHTEHFFCAQCGQQF--GEEGFHERD 449
            |:...||:.||...|..:||.|:..|  .|....|.|..:|...|.|..||:|.  ||: |...|
Mosquito    66 RERQIYCKTDYTKRFGTKCARCSRTISATDWVRRARDLIFHLACFACDSCGRQLSTGEQ-FALVD 129

  Fly   450 GKPYCRNDYFEMFAPKC-----NGC 469
            .|..|:..|.|||  .|     :||
Mosquito   130 DKVLCKTHYSEMF--DCGTSSDDGC 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830 17/53 (32%)
LIM2_Paxillin_like 407..458 CDD:188723 19/54 (35%)
LIM3_Paxillin_like 466..518 CDD:188724 3/9 (33%)
LIM4_Paxillin 525..576 CDD:188795
AgaP_AGAP006540XP_316578.4 LIM1_AWH 23..76 CDD:188759 16/52 (31%)
LIM2_AWH 84..138 CDD:188765 19/54 (35%)
Homeobox 167..219 CDD:278475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.