DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax and AgaP_AGAP012744

DIOPT Version :9

Sequence 1:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster
Sequence 2:XP_024667070.1 Gene:AgaP_AGAP012744 / 1268798 VectorBaseID:AGAP012744 Length:240 Species:Anopheles gambiae


Alignment Length:225 Identity:68/225 - (30%)
Similarity:104/225 - (46%) Gaps:21/225 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   348 CNACEKPIV--GQVITALGKTWHPEHFTCNHCSQELGTRNFFERDGFPYCEPDYHNLFSPRCAYC 410
            |..|::...  .:::.:.|:.||.:.|.|..|.::.....|:|.:|..|||.|:|.||:|.||.|
Mosquito    19 CTRCDEGFEPHERIVNSNGQLWHTQCFVCAQCFRQFQDGIFYEFEGRKYCEKDFHILFAPCCAKC 83

  Fly   411 NGAILDKCVTALDKTWHTEHFFCAQCGQQFGEEGFHERDGKPYCRN---DYFEMFAPK--CNGCN 470
            |..::.:.:.|:...||.:.|.|.:|.....:.|| .|:.||.|.:   ...|:...|  ||.|:
Mosquito    84 NNFVIGRVIKAMAANWHPQCFTCERCSIPLADSGF-IRNQKPLCHDCNRKEKEVGLGKLVCNKCH 147

  Fly   471 RAIMENYISALNSQWHPDCFVCRDCRQPF----------QGGSFFDHEGLPYCETHYHAKRG-SL 524
            ..|.:..:......:|...|.|..|....          .|.:..|...| || ...|.:.| .:
Mosquito   148 GIIDDAPLRFRGEVYHGYHFNCTSCGAELDSSAREVKNRSGYAANDMNEL-YC-LRCHDRMGIPI 210

  Fly   525 CAGCSKPITGRCITAMFKKFHPEHFVCAFC 554
            |..|.:||..|.:||:.|.:|.||||||.|
Mosquito   211 CGACRRPIEERVVTALGKHWHVEHFVCAKC 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830 15/53 (28%)
LIM2_Paxillin_like 407..458 CDD:188723 16/53 (30%)
LIM3_Paxillin_like 466..518 CDD:188724 13/61 (21%)
LIM4_Paxillin 525..576 CDD:188795 16/30 (53%)
AgaP_AGAP012744XP_024667070.1 LIM1_PINCH 19..77 CDD:188717 17/57 (30%)
LIM 80..130 CDD:295319 16/50 (32%)
LIM3_PINCH 143..203 CDD:188719 13/61 (21%)
LIM 209..>240 CDD:295319 15/30 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X39
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.