DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax and Pdlim3

DIOPT Version :9

Sequence 1:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_446102.2 Gene:Pdlim3 / 114108 RGDID:620427 Length:364 Species:Rattus norvegicus


Alignment Length:414 Identity:87/414 - (21%)
Similarity:133/414 - (32%) Gaps:127/414 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KIDPGARQPYRTARSKGILPGYALLADLQNSVPGQPQQPQPQYGTVQPKHQALQQQQFVDNTPGY 72
            :|.||::     |.:..:.||..:||     :.|        :||....|               
  Rat    31 RITPGSK-----AEAANLCPGDVILA-----IDG--------FGTESMTH--------------- 62

  Fly    73 GSLRGKAQPQVYQEHYSV-------ETR--SPTAGHDFNGSSTTPGYANQGSLPRQAAGASTGLS 128
                ..||.::....|.:       |||  ||....|        |.|:...:            
  Rat    63 ----ADAQDRIKAASYQLCLKIDRAETRLWSPQVSED--------GKAHPFKI------------ 103

  Fly   129 ELDSLLQDLQKIDVPVNYSTPVSKYNTMNSYATVEERPSVDSLLKELDNAHIYAVPNGSAHKSPT 193
            .|::..||       |||..  .|:|.......:..|.|..|....:|        .||...:|:
  Rat   104 NLEAEPQD-------VNYFE--HKHNIRPKPFIIPGRTSGCSTPSGID--------CGSGRSTPS 151

  Fly   194 PGRHV-TITVRETKTEKLTGPDGPVGTVEEQIVQQKDSYTPNHAVPGQQ-VHQAYTSQATKELDD 256
            ....| ||...:.|......|:.|:                ...:||.: ||..:.:......||
  Rat   152 SVSTVSTICPGDLKVAAKMAPNIPL----------------EMELPGVKIVHAQFNTPMQLYSDD 200

  Fly   257 LMASLSDFKVSNGTNGIGNGSH------PQQHSSTVQHQTVTDYARPNKGSQQAHLTQTIEETTI 315
            .:......:||.......:.|.      ||.....:.|....:.|.|    :|:...:.::|  :
  Rat   201 NIMETLQGQVSTALGETPSMSEPTASVPPQSDVYRMLHDNRDEPAAP----RQSGSFRVLQE--L 259

  Fly   316 VEDSREDQLDSMLGNLQANMSRQGVNTVQKGC--------CNACEKPIVGQVITALGKTWHPEHF 372
            |.|..:|:      .......|..|..|..|.        |:.|...|||.|:.|..|..|||.|
  Rat   260 VNDGSDDR------PAGTRSVRAPVTKVHGGAGGAQRMPLCDKCGSGIVGAVVKARDKYRHPECF 318

  Fly   373 TCNHCSQELGTRNFFERDGFPYCE 396
            .|..|:..|..:.:|..:|..|||
  Rat   319 VCADCNLNLKQKGYFFVEGELYCE 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830 20/49 (41%)
LIM2_Paxillin_like 407..458 CDD:188723
LIM3_Paxillin_like 466..518 CDD:188724
LIM4_Paxillin 525..576 CDD:188795
Pdlim3NP_446102.2 PDZ_signaling 2..80 CDD:238492 15/85 (18%)
DUF4749 184..263 CDD:406377 15/84 (18%)
LIM_ALP 294..346 CDD:188834 20/49 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.