DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax and Lmx1a

DIOPT Version :9

Sequence 1:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_387501.1 Gene:Lmx1a / 110648 MGIID:1888519 Length:382 Species:Mus musculus


Alignment Length:124 Identity:45/124 - (36%)
Similarity:59/124 - (47%) Gaps:7/124 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   404 SPR--CAYCNGAILDKCVTAL-DKTWHTEHFFCAQCGQQFGEEGFHERDGKPYCRNDYFEMFAPK 465
            ||:  |..|...|.|:.:..| |..||.:...||.|.:......|: ||.|.||:..|.::||.|
Mouse    30 SPKSVCEGCQRVISDRFLLRLNDSFWHEQCVQCASCKEPLETTCFY-RDKKLYCKYHYEKLFAVK 93

  Fly   466 CNGCNRAIMEN--YISALNSQWHPDCFVCRDC-RQPFQGGSFFDHEGLPYCETHYHAKR 521
            |.||..||..|  .:.|..|.:|..||.|..| ||..:|..|...||...|:..|..:|
Mouse    94 CGGCFEAIAPNEFVMRAQKSVYHLSCFCCCVCERQLQKGDEFVLKEGQLLCKGDYEKER 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830
LIM2_Paxillin_like 407..458 CDD:188723 17/51 (33%)
LIM3_Paxillin_like 466..518 CDD:188724 20/54 (37%)
LIM4_Paxillin 525..576 CDD:188795
Lmx1aNP_387501.1 LIM1_Lmx1a 35..86 CDD:188756 17/51 (33%)
LIM2_Lmx1a_Lmx1b 94..148 CDD:188764 20/53 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..208
Homeobox 198..252 CDD:365835
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 252..286
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.