DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax and atxn7l1

DIOPT Version :9

Sequence 1:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster
Sequence 2:XP_002933154.2 Gene:atxn7l1 / 100498036 XenbaseID:XB-GENE-1011002 Length:850 Species:Xenopus tropicalis


Alignment Length:363 Identity:79/363 - (21%)
Similarity:122/363 - (33%) Gaps:84/363 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PGARQPYRTARS----KGILPGYALLADLQNSVPGQPQQPQPQYGTVQPKHQALQQQQFVDN--- 68
            ||...  ||..|    .|:|...|  || .||:...|.......||:.......:....|..   
 Frog   541 PGTNS--RTTSSYMVTSGMLTNMA--AD-TNSLTSHPNAFSHATGTLNIVDSTFKSPSAVSPVPT 600

  Fly    69 -TPGYGSLRGKAQPQVYQEHYSVETRSPTAGHDFNGSSTTPGYANQGSLPRQAAGASTGLSELDS 132
             ||.......|.:|....:...:.:||.....:......|...:...|||.|.:..|:       
 Frog   601 LTPSPSQKPSKTKPSKSSKIKDLSSRSEELSGNRKKKPQTTSSSTSSSLPLQTSSTSS------- 658

  Fly   133 LLQDLQKIDVPVNYSTPVSKYNTMNSYATVEERPSVDSLLKELDNAHIYAVPNG----SAHKSPT 193
             .....|.:..:|.::.::.|...:||.:|           .:.||:     ||    ||...| 
 Frog   659 -FSGSHKKNCVLNSNSGLNSYQATSSYNSV-----------SVHNAN-----NGTSPLSAKLEP- 705

  Fly   194 PGRHVTITVRETKTEKLTGPDGPVGTVE--EQIVQQKDSYTPNHAV---PGQQ---VHQAYTSQA 250
            |||           ..|:|  ||..:::  ..:|...||.....::   ||:.   .|.|.:|..
 Frog   706 PGR-----------TSLSG--GPADSIKHMSMVVSSIDSSLSVSSLVHHPGEHTLAAHNAVSSMP 757

  Fly   251 T-------KELDDLMASLSDFKVSN--GTNGIGNGSHPQQHSSTVQHQTVTDYARPNKGSQQAHL 306
            .       |:..:..||....|::.  |.|.:...|.....||....|..:...:..|.|..| |
 Frog   758 LTFDKSEGKKRKNSSASSKACKITKMPGMNSVHKKSTANLISSVPDTQNSSLSRQMGKSSSIA-L 821

  Fly   307 TQTIEETTIVEDSREDQLDSMLGNLQANMSRQG-VNTV 343
            :|:...:|          .|...|.|...:|.| :.||
 Frog   822 SQSTSSST----------SSPAHNKQKTSNRTGRIRTV 849

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830
LIM2_Paxillin_like 407..458 CDD:188723
LIM3_Paxillin_like 466..518 CDD:188724
LIM4_Paxillin 525..576 CDD:188795
atxn7l1XP_002933154.2 SCA7 272..338 CDD:369807
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.