DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax and lmx1b.2

DIOPT Version :9

Sequence 1:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster
Sequence 2:XP_031755234.1 Gene:lmx1b.2 / 100497942 XenbaseID:XB-GENE-920041 Length:374 Species:Xenopus tropicalis


Alignment Length:142 Identity:42/142 - (29%)
Similarity:71/142 - (50%) Gaps:7/142 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   389 RDGFPYCEPDYHNLFSPRCAYCNGAILDKCVTAL-DKTWHTEHFFCAQCGQQFGEEGFHERDGKP 452
            |:..|:...|:.  .:..||.|...|.|:.:..: |::||.....||.|.|......:: |:.:.
 Frog    11 REHSPFLGLDHK--INEVCAGCGNTISDRFLLRVNDRSWHECCVKCAACLQILSGTCYY-RNRQL 72

  Fly   453 YCRNDYFEMFAPKCNGCNRAIM--ENYISALNSQWHPDCFVCRDC-RQPFQGGSFFDHEGLPYCE 514
            ||:.||.::||.|||.|.:.::  |..:..|::.:|..||.|.:| |:..:|..|...||...|.
 Frog    73 YCKEDYDKLFATKCNSCLKTVLPSELIMRVLSNVYHVACFFCCECERRLERGDEFVLKEGQLLCR 137

  Fly   515 THYHAKRGSLCA 526
            :.|..::..|.|
 Frog   138 SDYEREKEMLSA 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830 3/10 (30%)
LIM2_Paxillin_like 407..458 CDD:188723 15/51 (29%)
LIM3_Paxillin_like 466..518 CDD:188724 16/54 (30%)
LIM4_Paxillin 525..576 CDD:188795 1/2 (50%)
lmx1b.2XP_031755234.1 LIM1_Lmx1b 27..79 CDD:188757 16/52 (31%)
LIM 86..140 CDD:413332 16/53 (30%)
Homeobox 184..238 CDD:395001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.