DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax and lmx1al

DIOPT Version :9

Sequence 1:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster
Sequence 2:XP_009298059.1 Gene:lmx1al / 100149437 ZFINID:ZDB-GENE-131213-1 Length:406 Species:Danio rerio


Alignment Length:183 Identity:44/183 - (24%)
Similarity:63/183 - (34%) Gaps:64/183 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   348 CNACEKPIVGQVITALGK-TWHPEHFTCNHCSQELGTRNFFERDGFPYCEPDYHNLFSPRCAYCN 411
            |..||.||..:.:..:.: :||.   ||                              .:||.|.
Zfish    52 CAGCESPIADRFLLRVNELSWHE---TC------------------------------VKCAVCR 83

  Fly   412 GAILDKCVTALDKTWHTEHFFCAQCGQQFGEEGFHERDGKPYCRNDYFEMFAPKCNGCNRAI--M 474
            .|:...|             :|              ||...||::||.::|..||:.|.:||  .
Zfish    84 SALSGTC-------------YC--------------RDRLLYCKHDYEKLFVRKCSACLQAIGRS 121

  Fly   475 ENYISALNSQWHPDCFVCRDCRQPFQ-GGSFFDHEGLPYCETHYHAKRGSLCA 526
            |..:..|...:|..||.|.:|.:..| |..|...||...|...|..:|..|.|
Zfish   122 ELIMRVLGQVYHLGCFSCCECERRLQRGDEFVLKEGQLLCRGDYEKEREMLAA 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830 9/52 (17%)
LIM2_Paxillin_like 407..458 CDD:188723 10/50 (20%)
LIM3_Paxillin_like 466..518 CDD:188724 17/54 (31%)
LIM4_Paxillin 525..576 CDD:188795 1/2 (50%)
lmx1alXP_009298059.1 LIM1_Lmx1b 52..104 CDD:188757 20/111 (18%)
LIM 111..165 CDD:295319 17/53 (32%)
Homeobox 212..265 CDD:278475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.