DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pax and fhl5

DIOPT Version :9

Sequence 1:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001116957.1 Gene:fhl5 / 100144736 XenbaseID:XB-GENE-1002465 Length:282 Species:Xenopus tropicalis


Alignment Length:243 Identity:70/243 - (28%)
Similarity:106/243 - (43%) Gaps:8/243 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   341 NTVQKGCCNACEKPIV--GQVITALGKTWHPEHFTCNHCSQELGTRNFFERDGFPYCEPDYHNLF 403
            |::....|..|:|||.  .:.:......||...|.|:.|...|..:.|..:|....|...|...:
 Frog    34 NSLFANLCERCKKPIECNSKDLAYKDSHWHETCFKCDKCDHSLVEKPFAAKDELLLCIECYSTEY 98

  Fly   404 SPRCAYCNGAIL--DKCVTALDKTWHTEHFFCAQCGQQFGEEGFHERDGKPYCRNDYFEMFAPKC 466
            |.:|..|...|:  .:.:......||...|.|..|.:..|.:.|..::.|.||...|.:.||.:|
 Frog    99 SSKCFGCRATIMPGSRKMEYNGSNWHETCFVCQSCREPVGNKPFIPKESKIYCMPCYEKQFANQC 163

  Fly   467 NGCNRAIMENYISALNSQWHPDCFVCRDCRQPFQGGSFFDHEGLPYCETHYHAKRGSLCAGCSKP 531
            ..|.:||.:..:|....|||.:||||..|::...|......:..|||...:.......||.|:||
 Frog   164 KSCRKAITKGGLSFQEQQWHRECFVCTSCKKNLVGEKSTSRDESPYCVDCFDNLYAKKCAACAKP 228

  Fly   532 ITG----RCITAMFKKFHPEHFVCAFCLKQLNKGTFKEQKDKPYCHTC 575
            |||    :.|:...:::|.:.|.||.|.|.|....|...:|...|.:|
 Frog   229 ITGQGGAKYISFEDRQWHSDCFTCAKCSKSLVGEKFHTNEDDVLCPSC 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830 14/53 (26%)
LIM2_Paxillin_like 407..458 CDD:188723 13/52 (25%)
LIM3_Paxillin_like 466..518 CDD:188724 17/51 (33%)
LIM4_Paxillin 525..576 CDD:188795 20/55 (36%)
fhl5NP_001116957.1 LIM <6..33 CDD:351770
LIM1_FHL 37..95 CDD:188729 14/57 (25%)
LIM2_FHL 102..155 CDD:188731 13/52 (25%)
LIM3_FHL 163..214 CDD:188732 17/50 (34%)
LIM4_FHL 222..277 CDD:188733 20/55 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.